BLASTX nr result
ID: Rehmannia29_contig00033186
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00033186 (922 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN03686.1| (R)-limonene synthase [Handroanthus impetiginosus] 62 7e-07 >gb|PIN03686.1| (R)-limonene synthase [Handroanthus impetiginosus] Length = 606 Score = 61.6 bits (148), Expect = 7e-07 Identities = 38/79 (48%), Positives = 44/79 (55%), Gaps = 10/79 (12%) Frame = -1 Query: 256 RTNNHF-TF---------VCSINGASICLRRCSSQCKA*SACDDQIIPTRRRSENYNPAT 107 RTNN+ TF V S A+ LRRCS +C A D PTRRRS NY PA Sbjct: 13 RTNNYLCTFDRKAPKQWCVSSTTVAAAGLRRCSFKCNAKPYDHDHHAPTRRRSGNYKPAL 72 Query: 106 WDFDFIQPLSSE*IQGIYL 50 WDFD++Q LSSE + YL Sbjct: 73 WDFDYVQSLSSEYAEERYL 91