BLASTX nr result
ID: Rehmannia29_contig00033146
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00033146 (497 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|OVA18857.1| hypothetical protein BVC80_8807g13 [Macleaya cord... 54 2e-06 >gb|OVA18857.1| hypothetical protein BVC80_8807g13 [Macleaya cordata] Length = 87 Score = 53.5 bits (127), Expect = 2e-06 Identities = 27/57 (47%), Positives = 38/57 (66%), Gaps = 1/57 (1%) Frame = -3 Query: 495 EGYTGLIPYLYGLLIHGFQKRVGFQRLGMEELAD-AIPNRRFRVVGRVVMLLRKWER 328 +GYTG++PYLYG + ++R GFQ+LGM+E NRRFR+ G VM RK ++ Sbjct: 25 DGYTGVLPYLYG-VFRSVRRRWGFQKLGMDEQQPFGFLNRRFRIAGLAVMFSRKGKK 80