BLASTX nr result
ID: Rehmannia29_contig00032946
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00032946 (566 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012854343.1| PREDICTED: uncharacterized protein LOC105973... 57 4e-06 ref|XP_011082333.1| uncharacterized protein LOC105165136 [Sesamu... 57 4e-06 >ref|XP_012854343.1| PREDICTED: uncharacterized protein LOC105973836 [Erythranthe guttata] gb|EYU23295.1| hypothetical protein MIMGU_mgv1a001533mg [Erythranthe guttata] Length = 801 Score = 57.0 bits (136), Expect = 4e-06 Identities = 28/37 (75%), Positives = 30/37 (81%) Frame = +3 Query: 399 WSNYRSTVNITINKKRLMPALKCSVSLGFAVLFGLIY 509 WSNY ITINKKRLMPALKC++SLGFAV FG IY Sbjct: 379 WSNYNP---ITINKKRLMPALKCALSLGFAVFFGSIY 412 >ref|XP_011082333.1| uncharacterized protein LOC105165136 [Sesamum indicum] Length = 817 Score = 57.0 bits (136), Expect = 4e-06 Identities = 28/47 (59%), Positives = 36/47 (76%) Frame = +3 Query: 381 IVMSNLWSNYRSTVNITINKKRLMPALKCSVSLGFAVLFGLIYYLNN 521 + +S LWSN ITI+++RLMPAL+CS+SLGFA+LFGLIY N Sbjct: 388 LFLSKLWSNSP----ITISRRRLMPALRCSLSLGFAILFGLIYSKEN 430