BLASTX nr result
ID: Rehmannia29_contig00032940
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00032940 (483 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_017217607.1| PREDICTED: putative protease Do-like 14 [Dau... 59 4e-07 >ref|XP_017217607.1| PREDICTED: putative protease Do-like 14 [Daucus carota subsp. sativus] ref|XP_017217608.1| PREDICTED: putative protease Do-like 14 [Daucus carota subsp. sativus] ref|XP_017217610.1| PREDICTED: putative protease Do-like 14 [Daucus carota subsp. sativus] gb|KZM86900.1| hypothetical protein DCAR_024034 [Daucus carota subsp. sativus] Length = 423 Score = 58.9 bits (141), Expect = 4e-07 Identities = 25/52 (48%), Positives = 37/52 (71%) Frame = +2 Query: 2 LEFFELIWDKVGQSVHLAVLRPLDGSRWDVEVVVGNVDPNQFNRWPLLQTSK 157 L+ FEL+WDKVG +V L V+RP +G++ V V VG P++F RWPL+ ++ Sbjct: 353 LDLFELLWDKVGDTVELNVVRPSNGNQLKVNVTVGESTPDRFYRWPLIHWTR 404