BLASTX nr result
ID: Rehmannia29_contig00032843
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00032843 (492 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN14411.1| hypothetical protein CDL12_12962 [Handroanthus im... 102 1e-25 gb|PIN02972.1| hypothetical protein CDL12_24508 [Handroanthus im... 75 6e-15 gb|PHU12792.1| hypothetical protein BC332_19722 [Capsicum chinense] 61 5e-08 gb|PHT76927.1| hypothetical protein T459_20449 [Capsicum annuum] 60 1e-07 gb|KZM96402.1| hypothetical protein DCAR_019644 [Daucus carota s... 55 4e-07 >gb|PIN14411.1| hypothetical protein CDL12_12962 [Handroanthus impetiginosus] Length = 64 Score = 102 bits (254), Expect = 1e-25 Identities = 48/64 (75%), Positives = 57/64 (89%) Frame = +3 Query: 57 MAKIPKLRFTTEVAPPRFISITKRPLMKILDTIDEEKAYGATLLSSSNKMIDRERYHRQV 236 MAK PKLRF TEVAPPRFIS+TKRPL+K+L+TIDEEKAY + L +SNK+ D+ER+HRQV Sbjct: 1 MAKFPKLRFATEVAPPRFISVTKRPLVKMLETIDEEKAYASALSPASNKVHDQERHHRQV 60 Query: 237 SPFE 248 SPFE Sbjct: 61 SPFE 64 >gb|PIN02972.1| hypothetical protein CDL12_24508 [Handroanthus impetiginosus] Length = 57 Score = 74.7 bits (182), Expect = 6e-15 Identities = 34/46 (73%), Positives = 42/46 (91%) Frame = +3 Query: 57 MAKIPKLRFTTEVAPPRFISITKRPLMKILDTIDEEKAYGATLLSS 194 MAKIPK+RFTTEVAPP+FIS+ KRPL+K+L+TIDE+KAY + L SS Sbjct: 1 MAKIPKVRFTTEVAPPKFISVAKRPLIKLLETIDEDKAYASALSSS 46 >gb|PHU12792.1| hypothetical protein BC332_19722 [Capsicum chinense] Length = 299 Score = 61.2 bits (147), Expect = 5e-08 Identities = 31/59 (52%), Positives = 44/59 (74%), Gaps = 1/59 (1%) Frame = +3 Query: 57 MAKIPKLRFTTEVAPPRFISITKRPLMKILDTIDEEKAYGATLLSSS-NKMIDRERYHR 230 MAK PK+R++TEVAP R +S+ K P K LDTI EE+ Y T +SSS ++ +++ERYH+ Sbjct: 236 MAKAPKMRYSTEVAPSRLVSMVKGPPRKSLDTIIEEEDYLPTTVSSSVDRKMEQERYHK 294 >gb|PHT76927.1| hypothetical protein T459_20449 [Capsicum annuum] Length = 395 Score = 60.5 bits (145), Expect = 1e-07 Identities = 30/59 (50%), Positives = 44/59 (74%), Gaps = 1/59 (1%) Frame = +3 Query: 57 MAKIPKLRFTTEVAPPRFISITKRPLMKILDTIDEEKAYGATLLSSS-NKMIDRERYHR 230 MAK PK+R++TEVAP R +S+ K P + LDTI EE+ Y T +SSS ++ +++ERYH+ Sbjct: 332 MAKAPKMRYSTEVAPSRLVSMVKGPPRRSLDTIIEEEDYVPTTVSSSVDRKMEQERYHK 390 >gb|KZM96402.1| hypothetical protein DCAR_019644 [Daucus carota subsp. sativus] Length = 61 Score = 54.7 bits (130), Expect = 4e-07 Identities = 31/58 (53%), Positives = 41/58 (70%), Gaps = 3/58 (5%) Frame = +3 Query: 57 MAKIPKLRFTTEVAPPRFISITKRPLMKILDTIDEEKA--YGATLLSS-SNKMIDRER 221 MAKI LRF TEVAPPRFIS+ +RP+ K+L TI EE++ G +L +S +N D E+ Sbjct: 2 MAKIQTLRFVTEVAPPRFISVIRRPMKKLLATIHEEESEITGRSLPASLANSPTDHEK 59