BLASTX nr result
ID: Rehmannia29_contig00032760
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00032760 (409 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KZV16614.1| UDP-arabinose 4-epimerase 1 [Dorcoceras hygrometr... 120 8e-30 gb|PIN20376.1| UDP-glucose 4-epimerase/UDP-sulfoquinovose syntha... 119 3e-29 ref|XP_011085445.1| probable UDP-arabinose 4-epimerase 3 [Sesamu... 116 3e-28 ref|XP_022850413.1| UDP-arabinose 4-epimerase 1-like [Olea europ... 114 2e-27 gb|EPS59190.1| hypothetical protein M569_15620, partial [Genlise... 110 2e-27 ref|XP_011100374.1| UDP-arabinose 4-epimerase 1 [Sesamum indicum... 112 6e-27 ref|XP_022885880.1| UDP-arabinose 4-epimerase 1-like [Olea europ... 112 8e-27 emb|CDP12630.1| unnamed protein product [Coffea canephora] 112 1e-26 gb|ANC33519.1| UDP-xylose 4-epimerase [Ornithogalum longebractea... 112 2e-26 ref|XP_020678616.1| probable UDP-arabinose 4-epimerase 2 isoform... 111 2e-26 ref|XP_020678615.1| probable UDP-arabinose 4-epimerase 2 isoform... 111 2e-26 ref|XP_020677029.1| probable UDP-arabinose 4-epimerase 2 [Dendro... 110 4e-26 gb|OMP07650.1| NAD-dependent epimerase/dehydratase [Corchorus ol... 106 4e-26 ref|XP_015168656.1| PREDICTED: UDP-arabinose 4-epimerase 1-like ... 110 4e-26 ref|XP_006356905.1| PREDICTED: UDP-arabinose 4-epimerase 1-like ... 110 4e-26 ref|XP_012830902.1| PREDICTED: UDP-arabinose 4-epimerase 1-like ... 110 4e-26 ref|XP_010315646.1| PREDICTED: UDP-arabinose 4-epimerase 1 isofo... 108 6e-26 ref|XP_019231730.1| PREDICTED: UDP-arabinose 4-epimerase 1-like ... 110 8e-26 ref|XP_022873553.1| UDP-arabinose 4-epimerase 1-like [Olea europ... 105 9e-26 ref|XP_020221071.1| probable UDP-arabinose 4-epimerase 1 [Cajanu... 103 1e-25 >gb|KZV16614.1| UDP-arabinose 4-epimerase 1 [Dorcoceras hygrometricum] Length = 393 Score = 120 bits (301), Expect = 8e-30 Identities = 54/58 (93%), Positives = 57/58 (98%) Frame = +1 Query: 1 GVDIKVDYLSRRPGDYAEVYSDPSKIRNELNWTAKYTNLEESLTVAWRWQKAHINGYD 174 GVDIKVDYLSRRPGDYAEVYSDPSKI+NELNWTAKYTNLE+SL+VAWRWQKAH NGYD Sbjct: 332 GVDIKVDYLSRRPGDYAEVYSDPSKIKNELNWTAKYTNLEQSLSVAWRWQKAHRNGYD 389 >gb|PIN20376.1| UDP-glucose 4-epimerase/UDP-sulfoquinovose synthase [Handroanthus impetiginosus] Length = 390 Score = 119 bits (297), Expect = 3e-29 Identities = 52/58 (89%), Positives = 58/58 (100%) Frame = +1 Query: 1 GVDIKVDYLSRRPGDYAEVYSDPSKIRNELNWTAKYTNLEESLTVAWRWQKAHINGYD 174 GV+IKV++LSRRPGDYAEVYSDPSKI+NELNWTAKYTNLEESL++AWRWQKAHINGYD Sbjct: 332 GVNIKVEFLSRRPGDYAEVYSDPSKIKNELNWTAKYTNLEESLSIAWRWQKAHINGYD 389 >ref|XP_011085445.1| probable UDP-arabinose 4-epimerase 3 [Sesamum indicum] ref|XP_011085446.1| probable UDP-arabinose 4-epimerase 3 [Sesamum indicum] ref|XP_011085447.1| probable UDP-arabinose 4-epimerase 3 [Sesamum indicum] ref|XP_020551553.1| probable UDP-arabinose 4-epimerase 3 [Sesamum indicum] ref|XP_020551554.1| probable UDP-arabinose 4-epimerase 3 [Sesamum indicum] Length = 390 Score = 116 bits (290), Expect = 3e-28 Identities = 50/58 (86%), Positives = 56/58 (96%) Frame = +1 Query: 1 GVDIKVDYLSRRPGDYAEVYSDPSKIRNELNWTAKYTNLEESLTVAWRWQKAHINGYD 174 GVDIKVD+LSRRPGDYAEVYSDPSKI NELNWTA++TNLEESL++AWRWQK H+NGYD Sbjct: 332 GVDIKVDFLSRRPGDYAEVYSDPSKINNELNWTARFTNLEESLSIAWRWQKEHLNGYD 389 >ref|XP_022850413.1| UDP-arabinose 4-epimerase 1-like [Olea europaea var. sylvestris] ref|XP_022850414.1| UDP-arabinose 4-epimerase 1-like [Olea europaea var. sylvestris] Length = 389 Score = 114 bits (284), Expect = 2e-27 Identities = 50/58 (86%), Positives = 55/58 (94%) Frame = +1 Query: 1 GVDIKVDYLSRRPGDYAEVYSDPSKIRNELNWTAKYTNLEESLTVAWRWQKAHINGYD 174 GV+IKVDYLSRRPGDYAEVYSDPSKI+NELNW+AKYTNLEESL +AWRWQK H NGY+ Sbjct: 331 GVNIKVDYLSRRPGDYAEVYSDPSKIKNELNWSAKYTNLEESLAIAWRWQKTHRNGYN 388 >gb|EPS59190.1| hypothetical protein M569_15620, partial [Genlisea aurea] Length = 243 Score = 110 bits (276), Expect = 2e-27 Identities = 49/57 (85%), Positives = 54/57 (94%) Frame = +1 Query: 1 GVDIKVDYLSRRPGDYAEVYSDPSKIRNELNWTAKYTNLEESLTVAWRWQKAHINGY 171 GVDIKV+YLSRRPGDYAEVYSDPSKIRNELNWTAK+T+L+ SL+ AWRWQKAH NGY Sbjct: 187 GVDIKVEYLSRRPGDYAEVYSDPSKIRNELNWTAKFTDLQHSLSTAWRWQKAHRNGY 243 >ref|XP_011100374.1| UDP-arabinose 4-epimerase 1 [Sesamum indicum] ref|XP_011100377.1| UDP-arabinose 4-epimerase 1 [Sesamum indicum] ref|XP_011100378.1| UDP-arabinose 4-epimerase 1 [Sesamum indicum] ref|XP_020555023.1| UDP-arabinose 4-epimerase 1 [Sesamum indicum] Length = 389 Score = 112 bits (281), Expect = 6e-27 Identities = 51/58 (87%), Positives = 54/58 (93%) Frame = +1 Query: 1 GVDIKVDYLSRRPGDYAEVYSDPSKIRNELNWTAKYTNLEESLTVAWRWQKAHINGYD 174 GVDIKVDYL RRPGDYAEVYSDPSKI N+LNW AKYTNLEESL+VAWRWQKAH NGY+ Sbjct: 332 GVDIKVDYLDRRPGDYAEVYSDPSKIWNQLNWKAKYTNLEESLSVAWRWQKAHRNGYN 389 >ref|XP_022885880.1| UDP-arabinose 4-epimerase 1-like [Olea europaea var. sylvestris] ref|XP_022885881.1| UDP-arabinose 4-epimerase 1-like [Olea europaea var. sylvestris] ref|XP_022885882.1| UDP-arabinose 4-epimerase 1-like [Olea europaea var. sylvestris] Length = 390 Score = 112 bits (280), Expect = 8e-27 Identities = 50/58 (86%), Positives = 53/58 (91%) Frame = +1 Query: 1 GVDIKVDYLSRRPGDYAEVYSDPSKIRNELNWTAKYTNLEESLTVAWRWQKAHINGYD 174 GV+IKVDYLSRRPGDYAEVYSDPSKI NELNW AKYTNLEESL +AWRWQK H NGY+ Sbjct: 332 GVNIKVDYLSRRPGDYAEVYSDPSKINNELNWLAKYTNLEESLAIAWRWQKTHRNGYN 389 >emb|CDP12630.1| unnamed protein product [Coffea canephora] Length = 415 Score = 112 bits (280), Expect = 1e-26 Identities = 50/57 (87%), Positives = 53/57 (92%) Frame = +1 Query: 1 GVDIKVDYLSRRPGDYAEVYSDPSKIRNELNWTAKYTNLEESLTVAWRWQKAHINGY 171 GV +KVDYL RRPGDYAEVYSDP+KIR ELNWTAKYTNL+ESL VAWRWQKAHINGY Sbjct: 353 GVPLKVDYLPRRPGDYAEVYSDPTKIRTELNWTAKYTNLQESLRVAWRWQKAHINGY 409 >gb|ANC33519.1| UDP-xylose 4-epimerase [Ornithogalum longebracteatum] Length = 416 Score = 112 bits (279), Expect = 2e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 1 GVDIKVDYLSRRPGDYAEVYSDPSKIRNELNWTAKYTNLEESLTVAWRWQKAHINGY 171 GVDIKVDYLSRRPGDYAEVYSDPSKI NELNWTA+YT+L+ESL VAWRWQK+H NGY Sbjct: 352 GVDIKVDYLSRRPGDYAEVYSDPSKINNELNWTAQYTDLQESLRVAWRWQKSHPNGY 408 >ref|XP_020678616.1| probable UDP-arabinose 4-epimerase 2 isoform X2 [Dendrobium catenatum] ref|XP_020678617.1| probable UDP-arabinose 4-epimerase 2 isoform X2 [Dendrobium catenatum] Length = 396 Score = 111 bits (278), Expect = 2e-26 Identities = 49/58 (84%), Positives = 53/58 (91%) Frame = +1 Query: 1 GVDIKVDYLSRRPGDYAEVYSDPSKIRNELNWTAKYTNLEESLTVAWRWQKAHINGYD 174 GVDIKVDYL RRPGDYAEVYSDPSKI ELNWTAKYT+LE+SL +AWRWQK+H NGYD Sbjct: 332 GVDIKVDYLERRPGDYAEVYSDPSKINKELNWTAKYTDLEQSLRIAWRWQKSHRNGYD 389 >ref|XP_020678615.1| probable UDP-arabinose 4-epimerase 2 isoform X1 [Dendrobium catenatum] gb|PKU63423.1| putative UDP-arabinose 4-epimerase 1 [Dendrobium catenatum] Length = 417 Score = 111 bits (278), Expect = 2e-26 Identities = 49/58 (84%), Positives = 53/58 (91%) Frame = +1 Query: 1 GVDIKVDYLSRRPGDYAEVYSDPSKIRNELNWTAKYTNLEESLTVAWRWQKAHINGYD 174 GVDIKVDYL RRPGDYAEVYSDPSKI ELNWTAKYT+LE+SL +AWRWQK+H NGYD Sbjct: 353 GVDIKVDYLERRPGDYAEVYSDPSKINKELNWTAKYTDLEQSLRIAWRWQKSHRNGYD 410 >ref|XP_020677029.1| probable UDP-arabinose 4-epimerase 2 [Dendrobium catenatum] gb|PKU70742.1| putative UDP-arabinose 4-epimerase 3 [Dendrobium catenatum] Length = 407 Score = 110 bits (276), Expect = 4e-26 Identities = 50/57 (87%), Positives = 52/57 (91%) Frame = +1 Query: 1 GVDIKVDYLSRRPGDYAEVYSDPSKIRNELNWTAKYTNLEESLTVAWRWQKAHINGY 171 GVDIKVDYL RRPGDYAEVYSDPSKI ELNWTAKYTNLEESL VAW+WQK+H NGY Sbjct: 346 GVDIKVDYLERRPGDYAEVYSDPSKIYQELNWTAKYTNLEESLKVAWKWQKSHRNGY 402 >gb|OMP07650.1| NAD-dependent epimerase/dehydratase [Corchorus olitorius] Length = 191 Score = 106 bits (264), Expect = 4e-26 Identities = 46/58 (79%), Positives = 53/58 (91%) Frame = +1 Query: 1 GVDIKVDYLSRRPGDYAEVYSDPSKIRNELNWTAKYTNLEESLTVAWRWQKAHINGYD 174 G DIKV+ LSRRPGDYAEVYSDPSKIR ELNWTA++TNLE SL ++WRWQK+H+NGYD Sbjct: 128 GKDIKVENLSRRPGDYAEVYSDPSKIRRELNWTAQHTNLETSLRISWRWQKSHVNGYD 185 >ref|XP_015168656.1| PREDICTED: UDP-arabinose 4-epimerase 1-like isoform X2 [Solanum tuberosum] Length = 417 Score = 110 bits (276), Expect = 4e-26 Identities = 48/59 (81%), Positives = 55/59 (93%) Frame = +1 Query: 1 GVDIKVDYLSRRPGDYAEVYSDPSKIRNELNWTAKYTNLEESLTVAWRWQKAHINGYDL 177 GV IKVD+L RRPGDYAEVYSDP+KIRNELNWTAKYT+L+ESL +AWRWQK+H+NGY L Sbjct: 352 GVPIKVDFLPRRPGDYAEVYSDPTKIRNELNWTAKYTDLQESLQIAWRWQKSHLNGYGL 410 >ref|XP_006356905.1| PREDICTED: UDP-arabinose 4-epimerase 1-like isoform X1 [Solanum tuberosum] Length = 418 Score = 110 bits (276), Expect = 4e-26 Identities = 48/59 (81%), Positives = 55/59 (93%) Frame = +1 Query: 1 GVDIKVDYLSRRPGDYAEVYSDPSKIRNELNWTAKYTNLEESLTVAWRWQKAHINGYDL 177 GV IKVD+L RRPGDYAEVYSDP+KIRNELNWTAKYT+L+ESL +AWRWQK+H+NGY L Sbjct: 353 GVPIKVDFLPRRPGDYAEVYSDPTKIRNELNWTAKYTDLQESLQIAWRWQKSHLNGYGL 411 >ref|XP_012830902.1| PREDICTED: UDP-arabinose 4-epimerase 1-like [Erythranthe guttata] gb|EYU42844.1| hypothetical protein MIMGU_mgv1a007948mg [Erythranthe guttata] Length = 390 Score = 110 bits (275), Expect = 4e-26 Identities = 50/58 (86%), Positives = 53/58 (91%) Frame = +1 Query: 1 GVDIKVDYLSRRPGDYAEVYSDPSKIRNELNWTAKYTNLEESLTVAWRWQKAHINGYD 174 GV+IKVDYL RR GDYAEVYSDPSKI NELNW AKYTNL+ESL VAWRWQKAHINGY+ Sbjct: 332 GVNIKVDYLDRRAGDYAEVYSDPSKIFNELNWKAKYTNLQESLAVAWRWQKAHINGYE 389 >ref|XP_010315646.1| PREDICTED: UDP-arabinose 4-epimerase 1 isoform X6 [Solanum lycopersicum] Length = 305 Score = 108 bits (270), Expect = 6e-26 Identities = 46/59 (77%), Positives = 55/59 (93%) Frame = +1 Query: 1 GVDIKVDYLSRRPGDYAEVYSDPSKIRNELNWTAKYTNLEESLTVAWRWQKAHINGYDL 177 GV IKV++L RRPGDYAEVYSDP+KIRNELNWTAKYT+L++SL +AWRWQK+H+NGY L Sbjct: 242 GVPIKVEFLPRRPGDYAEVYSDPTKIRNELNWTAKYTDLQQSLQIAWRWQKSHLNGYSL 300 >ref|XP_019231730.1| PREDICTED: UDP-arabinose 4-epimerase 1-like [Nicotiana attenuata] ref|XP_019231735.1| PREDICTED: UDP-arabinose 4-epimerase 1-like [Nicotiana attenuata] ref|XP_019231740.1| PREDICTED: UDP-arabinose 4-epimerase 1-like [Nicotiana attenuata] gb|OIT06610.1| udp-arabinose 4-epimerase 1 [Nicotiana attenuata] Length = 420 Score = 110 bits (274), Expect = 8e-26 Identities = 48/57 (84%), Positives = 54/57 (94%) Frame = +1 Query: 1 GVDIKVDYLSRRPGDYAEVYSDPSKIRNELNWTAKYTNLEESLTVAWRWQKAHINGY 171 GV IKVD+L RRPGDYAEVYSDP+KIRNELNWTAKYT+L+ESL VAWRWQK+H+NGY Sbjct: 353 GVPIKVDFLPRRPGDYAEVYSDPTKIRNELNWTAKYTDLQESLQVAWRWQKSHLNGY 409 >ref|XP_022873553.1| UDP-arabinose 4-epimerase 1-like [Olea europaea var. sylvestris] Length = 195 Score = 105 bits (262), Expect = 9e-26 Identities = 45/57 (78%), Positives = 54/57 (94%) Frame = +1 Query: 1 GVDIKVDYLSRRPGDYAEVYSDPSKIRNELNWTAKYTNLEESLTVAWRWQKAHINGY 171 GV IKVD+L RRPGDYAEVYSDP+KIR+ELNWTAK+T+L++SL +AWRWQKAH+NGY Sbjct: 131 GVPIKVDFLPRRPGDYAEVYSDPTKIRDELNWTAKHTDLQKSLQIAWRWQKAHLNGY 187 >ref|XP_020221071.1| probable UDP-arabinose 4-epimerase 1 [Cajanus cajan] Length = 146 Score = 103 bits (258), Expect = 1e-25 Identities = 44/59 (74%), Positives = 53/59 (89%) Frame = +1 Query: 1 GVDIKVDYLSRRPGDYAEVYSDPSKIRNELNWTAKYTNLEESLTVAWRWQKAHINGYDL 177 GVDIKVD+L RRPGDYAEVYSDPSKI ELNWTA+YT+LE+S+ +AW+WQK+H NGY + Sbjct: 84 GVDIKVDFLPRRPGDYAEVYSDPSKINRELNWTAQYTDLEKSIQIAWKWQKSHRNGYGI 142 Score = 79.0 bits (193), Expect = 6e-16 Identities = 36/45 (80%), Positives = 41/45 (91%) Frame = +1 Query: 1 GVDIKVDYLSRRPGDYAEVYSDPSKIRNELNWTAKYTNLEESLTV 135 GVDIKVD+L RRPGDYAEVYSDPSKI ELNWTA+YT+LE+S +V Sbjct: 28 GVDIKVDFLPRRPGDYAEVYSDPSKINRELNWTAQYTDLEKSRSV 72