BLASTX nr result
ID: Rehmannia29_contig00032682
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00032682 (405 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011078030.1| serine/threonine-protein kinase 38-like [Ses... 61 4e-08 ref|XP_012848812.1| PREDICTED: serine/threonine-protein kinase t... 59 3e-07 ref|XP_012848811.1| PREDICTED: serine/threonine-protein kinase t... 59 3e-07 >ref|XP_011078030.1| serine/threonine-protein kinase 38-like [Sesamum indicum] Length = 529 Score = 60.8 bits (146), Expect = 4e-08 Identities = 30/46 (65%), Positives = 35/46 (76%) Frame = -1 Query: 402 NKNGTSPERLSTDSTLSDSGVDYSTENTTNESEVLKRASSADTLPR 265 NK G SPERLSTDST SDSGVDYS + +++ E LKR SS TLP+ Sbjct: 482 NKKGISPERLSTDSTRSDSGVDYSLKYNSDQEEDLKRTSSTGTLPQ 527 >ref|XP_012848812.1| PREDICTED: serine/threonine-protein kinase tricorner-like isoform X2 [Erythranthe guttata] gb|EYU27333.1| hypothetical protein MIMGU_mgv1a004283mg [Erythranthe guttata] Length = 535 Score = 58.5 bits (140), Expect = 3e-07 Identities = 29/41 (70%), Positives = 32/41 (78%) Frame = -1 Query: 396 NGTSPERLSTDSTLSDSGVDYSTENTTNESEVLKRASSADT 274 N TSPERLSTDS+ SDS VDYS+ N T E E+LKR SS DT Sbjct: 492 NSTSPERLSTDSSRSDSAVDYSSNNATVEVELLKRTSSVDT 532 >ref|XP_012848811.1| PREDICTED: serine/threonine-protein kinase tricorner-like isoform X1 [Erythranthe guttata] Length = 559 Score = 58.5 bits (140), Expect = 3e-07 Identities = 29/41 (70%), Positives = 32/41 (78%) Frame = -1 Query: 396 NGTSPERLSTDSTLSDSGVDYSTENTTNESEVLKRASSADT 274 N TSPERLSTDS+ SDS VDYS+ N T E E+LKR SS DT Sbjct: 516 NSTSPERLSTDSSRSDSAVDYSSNNATVEVELLKRTSSVDT 556