BLASTX nr result
ID: Rehmannia29_contig00032458
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00032458 (475 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN02076.1| hypothetical protein CDL12_25407 [Handroanthus im... 74 3e-14 >gb|PIN02076.1| hypothetical protein CDL12_25407 [Handroanthus impetiginosus] gb|PIN04859.1| hypothetical protein CDL12_22602 [Handroanthus impetiginosus] Length = 93 Score = 73.9 bits (180), Expect = 3e-14 Identities = 41/93 (44%), Positives = 56/93 (60%) Frame = -2 Query: 465 MEKIGENQREEELKSHTAIRCAKAAXXXXXXXXXXXXXXXXXXXLQDXXXXXXXXXXMVK 286 MEKIGE+ +E+ELKSHTAIRCAKAA +Q+ +VK Sbjct: 1 MEKIGEDLQEKELKSHTAIRCAKAAILLSSLRNATNSFTSDVPQIQEDEKIEMLKIELVK 60 Query: 285 LRKKIKKLRQCMGVMFLSYVLIFLLVPLVIKSL 187 ++K+KK+R +GV LSY+LIFL++P +KSL Sbjct: 61 KKQKLKKMRLWIGVSLLSYLLIFLILPFFLKSL 93