BLASTX nr result
ID: Rehmannia29_contig00032456
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00032456 (507 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011074851.1| uncharacterized protein LOC105159468 [Sesamu... 72 1e-11 >ref|XP_011074851.1| uncharacterized protein LOC105159468 [Sesamum indicum] Length = 424 Score = 72.0 bits (175), Expect = 1e-11 Identities = 34/59 (57%), Positives = 43/59 (72%) Frame = +2 Query: 2 LDKTKPVKEHRCTEFDNYYVRKANLSPNLPPMEDLKHGQPENAILGDFEFELQEEDKQL 178 L+KTKPVK+H CT+FD RKA S ++P MEDLKHGQ EN D E E+Q++DK+L Sbjct: 43 LEKTKPVKQHGCTDFDE---RKARSSQDVPAMEDLKHGQEENVSTSDLEVEMQKQDKEL 98