BLASTX nr result
ID: Rehmannia29_contig00032355
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00032355 (480 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011094271.1| UPF0496 protein At3g19330 [Sesamum indicum] ... 123 1e-30 gb|PIN14182.1| hypothetical protein CDL12_13188 [Handroanthus im... 123 1e-30 gb|PIN17463.1| hypothetical protein CDL12_09864 [Handroanthus im... 114 2e-27 ref|XP_012828684.1| PREDICTED: UPF0496 protein At3g19330-like [E... 103 2e-23 ref|XP_012836152.1| PREDICTED: UPF0496 protein At3g19330-like [E... 103 3e-23 ref|XP_011077825.1| UPF0496 protein At3g19330 [Sesamum indicum] ... 103 3e-23 ref|XP_022887222.1| UPF0496 protein At3g19330-like [Olea europae... 96 2e-20 gb|KZV43157.1| hypothetical protein F511_40541 [Dorcoceras hygro... 95 6e-20 ref|XP_019195747.1| PREDICTED: UPF0496 protein At3g19330-like [I... 87 3e-17 emb|CDP10627.1| unnamed protein product [Coffea canephora] 84 6e-16 ref|XP_017255391.1| PREDICTED: UPF0496 protein At3g19330 [Daucus... 81 5e-15 gb|EYU18084.1| hypothetical protein MIMGU_mgv1a025599mg, partial... 75 7e-13 ref|XP_017975120.1| PREDICTED: UPF0496 protein At3g19330 [Theobr... 73 4e-12 gb|EOY02975.1| Uncharacterized protein TCM_017367 isoform 1 [The... 73 5e-12 ref|XP_021297889.1| UPF0496 protein At3g19330-like isoform X2 [H... 69 9e-11 gb|KZM91905.1| hypothetical protein DCAR_020730 [Daucus carota s... 69 1e-10 ref|XP_006378820.1| hypothetical protein POPTR_0010s24650g [Popu... 67 4e-10 ref|XP_011024180.1| PREDICTED: UPF0496 protein At3g19330-like [P... 65 2e-09 ref|XP_004228688.1| PREDICTED: UPF0496 protein At3g19330 isoform... 65 4e-09 gb|PHT99096.1| hypothetical protein BC332_31933 [Capsicum chinense] 63 2e-08 >ref|XP_011094271.1| UPF0496 protein At3g19330 [Sesamum indicum] ref|XP_011094275.1| UPF0496 protein At3g19330 [Sesamum indicum] ref|XP_011094276.1| UPF0496 protein At3g19330 [Sesamum indicum] ref|XP_020553231.1| UPF0496 protein At3g19330 [Sesamum indicum] ref|XP_020553233.1| UPF0496 protein At3g19330 [Sesamum indicum] ref|XP_020553234.1| UPF0496 protein At3g19330 [Sesamum indicum] Length = 381 Score = 123 bits (309), Expect = 1e-30 Identities = 64/88 (72%), Positives = 70/88 (79%), Gaps = 1/88 (1%) Frame = -2 Query: 263 MLPCLKP-HPPPTNNYLSSPTSQGYSGENTPASSVQLSPTINLTREYTLALQTNSYSEIR 87 +L CLKP PP TNNYLSSP SQGYS + TP SSVQLSPT+NL+REYTLA+QTNSY EIR Sbjct: 10 ILSCLKPPRPPSTNNYLSSPASQGYSEDITPPSSVQLSPTVNLSREYTLAVQTNSYGEIR 69 Query: 86 STFDQDNSIDQNVEIGHVDVSEEPQLLE 3 TFDQD NV IGH+D EEPQLLE Sbjct: 70 RTFDQD-----NVAIGHIDFFEEPQLLE 92 >gb|PIN14182.1| hypothetical protein CDL12_13188 [Handroanthus impetiginosus] gb|PIN16119.1| hypothetical protein CDL12_11228 [Handroanthus impetiginosus] Length = 392 Score = 123 bits (309), Expect = 1e-30 Identities = 65/99 (65%), Positives = 73/99 (73%), Gaps = 1/99 (1%) Frame = -2 Query: 296 DFWLRWIPQGSMLPCLKPHPPP-TNNYLSSPTSQGYSGENTPASSVQLSPTINLTREYTL 120 DFW + G ML CLK PP TN Y SSP SQG+S ENTP SS Q SPTINLT E+T Sbjct: 8 DFWSA-LKDGRMLSCLKTLPPASTNTYFSSPASQGHSVENTPRSSAQFSPTINLTEEFTH 66 Query: 119 ALQTNSYSEIRSTFDQDNSIDQNVEIGHVDVSEEPQLLE 3 A+QT+SY EIR TFDQD+S DQNV+I +VD EEPQLLE Sbjct: 67 AVQTHSYGEIRRTFDQDSSFDQNVDIENVDFVEEPQLLE 105 >gb|PIN17463.1| hypothetical protein CDL12_09864 [Handroanthus impetiginosus] Length = 371 Score = 114 bits (286), Expect = 2e-27 Identities = 61/88 (69%), Positives = 69/88 (78%), Gaps = 1/88 (1%) Frame = -2 Query: 263 MLPCLKPHPPP-TNNYLSSPTSQGYSGENTPASSVQLSPTINLTREYTLALQTNSYSEIR 87 ML CLK PPP T+N +SSP SQGYS +NTP SSVQLSPT+NLTREYTLALQTNSYSEIR Sbjct: 1 MLSCLKQPPPPSTSNNISSPASQGYSADNTPTSSVQLSPTVNLTREYTLALQTNSYSEIR 60 Query: 86 STFDQDNSIDQNVEIGHVDVSEEPQLLE 3 + ++ + EIGHVDV EPQLLE Sbjct: 61 T------ALGRIAEIGHVDVFGEPQLLE 82 >ref|XP_012828684.1| PREDICTED: UPF0496 protein At3g19330-like [Erythranthe guttata] Length = 328 Score = 103 bits (257), Expect = 2e-23 Identities = 54/88 (61%), Positives = 67/88 (76%), Gaps = 1/88 (1%) Frame = -2 Query: 263 MLPCLKPHPPPTNNY-LSSPTSQGYSGENTPASSVQLSPTINLTREYTLALQTNSYSEIR 87 MLPCLKP P N+ +SSPTSQGYS +NTP SSVQLSPT+NL+RE+TLA++TNSY+EIR Sbjct: 1 MLPCLKPAPSANNHISISSPTSQGYSADNTPTSSVQLSPTVNLSREFTLAVKTNSYNEIR 60 Query: 86 STFDQDNSIDQNVEIGHVDVSEEPQLLE 3 TFDQ + +Q V+ EE QLL+ Sbjct: 61 KTFDQIANTEQ------VEFHEETQLLD 82 >ref|XP_012836152.1| PREDICTED: UPF0496 protein At3g19330-like [Erythranthe guttata] ref|XP_012836153.1| PREDICTED: UPF0496 protein At3g19330-like [Erythranthe guttata] Length = 388 Score = 103 bits (258), Expect = 3e-23 Identities = 59/92 (64%), Positives = 64/92 (69%), Gaps = 5/92 (5%) Frame = -2 Query: 263 MLPCLKPHPPP-TNNYLSSPTSQGYSGENTPASSVQLSPT--INLTREYTLALQTNSYSE 93 ML CLK PP TNNYLSSP SQ YS E TP S+ Q SPT INLT EYTL +QT SY E Sbjct: 1 MLSCLKSLPPSSTNNYLSSPASQAYSVEETPRSNAQPSPTPTINLTEEYTLVVQTTSYGE 60 Query: 92 IRSTFDQDNS--IDQNVEIGHVDVSEEPQLLE 3 IR TFDQD + DQN EI VD +EPQLL+ Sbjct: 61 IRRTFDQDGTYYADQNAEIEQVDSIDEPQLLD 92 >ref|XP_011077825.1| UPF0496 protein At3g19330 [Sesamum indicum] ref|XP_020549676.1| UPF0496 protein At3g19330 [Sesamum indicum] Length = 377 Score = 103 bits (257), Expect = 3e-23 Identities = 55/88 (62%), Positives = 63/88 (71%), Gaps = 1/88 (1%) Frame = -2 Query: 263 MLPCLKPHPPP-TNNYLSSPTSQGYSGENTPASSVQLSPTINLTREYTLALQTNSYSEIR 87 ML C+K P P TNN SS SQG S ENTP QLS TINL+ EY LA+QT+SY EI+ Sbjct: 1 MLFCVKQLPTPSTNNDYSSSVSQGSSVENTPRRGAQLSATINLSEEYALAVQTHSYGEIQ 60 Query: 86 STFDQDNSIDQNVEIGHVDVSEEPQLLE 3 TFDQDNS DQ ++ +VD SEEPQLLE Sbjct: 61 RTFDQDNSFDQTIDFENVDFSEEPQLLE 88 >ref|XP_022887222.1| UPF0496 protein At3g19330-like [Olea europaea var. sylvestris] ref|XP_022887223.1| UPF0496 protein At3g19330-like [Olea europaea var. sylvestris] ref|XP_022887224.1| UPF0496 protein At3g19330-like [Olea europaea var. sylvestris] ref|XP_022887225.1| UPF0496 protein At3g19330-like [Olea europaea var. sylvestris] Length = 385 Score = 95.9 bits (237), Expect = 2e-20 Identities = 48/91 (52%), Positives = 65/91 (71%), Gaps = 4/91 (4%) Frame = -2 Query: 263 MLPCLKPHPPP--TNNYLSSPTSQGYSGE--NTPASSVQLSPTINLTREYTLALQTNSYS 96 M+ CL+P P TNNY+SSP SQ +S NTP SS Q+SPT+NLT+EY A++TNS+ Sbjct: 1 MMSCLRPLPSTSTTNNYISSPASQEFSHSVGNTPTSSSQISPTVNLTQEYRYAVETNSFG 60 Query: 95 EIRSTFDQDNSIDQNVEIGHVDVSEEPQLLE 3 EIR+ QD+S+DQ +++ D S+E QLLE Sbjct: 61 EIRNVIHQDSSLDQYIDLEQADFSQESQLLE 91 >gb|KZV43157.1| hypothetical protein F511_40541 [Dorcoceras hygrometricum] Length = 381 Score = 94.7 bits (234), Expect = 6e-20 Identities = 50/94 (53%), Positives = 65/94 (69%), Gaps = 7/94 (7%) Frame = -2 Query: 263 MLPCLKPHPPPT-------NNYLSSPTSQGYSGENTPASSVQLSPTINLTREYTLALQTN 105 ML CL+ PPP NN++SSP SQGYS +NTP SSVQLS T+NL+ EY+LA++T Sbjct: 1 MLSCLRQQPPPPPPRLPTKNNHISSPVSQGYSADNTPTSSVQLSSTVNLSGEYSLAIKTY 60 Query: 104 SYSEIRSTFDQDNSIDQNVEIGHVDVSEEPQLLE 3 SYSEIR FD+++S D+ V+I + EP LE Sbjct: 61 SYSEIRRVFDRNSSFDRYVDI---EYFAEPPALE 91 >ref|XP_019195747.1| PREDICTED: UPF0496 protein At3g19330-like [Ipomoea nil] ref|XP_019195748.1| PREDICTED: UPF0496 protein At3g19330-like [Ipomoea nil] Length = 379 Score = 87.4 bits (215), Expect = 3e-17 Identities = 44/87 (50%), Positives = 55/87 (63%) Frame = -2 Query: 263 MLPCLKPHPPPTNNYLSSPTSQGYSGENTPASSVQLSPTINLTREYTLALQTNSYSEIRS 84 M+PC TNN+L GYS ENTP S VQ+SPT+NL R YTLA+QT S+ EI + Sbjct: 1 MIPCFGQSSTTTNNHLRPSALDGYSVENTPQSGVQISPTVNLRRAYTLAVQTPSFGEIWT 60 Query: 83 TFDQDNSIDQNVEIGHVDVSEEPQLLE 3 Q+ +QNV++ VDV EEP LE Sbjct: 61 KIHQEIPSEQNVDVSEVDVIEEPLQLE 87 >emb|CDP10627.1| unnamed protein product [Coffea canephora] Length = 425 Score = 84.0 bits (206), Expect = 6e-16 Identities = 46/89 (51%), Positives = 61/89 (68%), Gaps = 2/89 (2%) Frame = -2 Query: 263 MLPCLKPHPPP--TNNYLSSPTSQGYSGENTPASSVQLSPTINLTREYTLALQTNSYSEI 90 MLPCL+P P TN++ S SQG S + T ASS Q SPT+NLTREY A+QT+SYSEI Sbjct: 1 MLPCLRPSPSTAATNSHASPTFSQG-SVDGTAASSFQPSPTVNLTREYACAVQTSSYSEI 59 Query: 89 RSTFDQDNSIDQNVEIGHVDVSEEPQLLE 3 S D+ ++ V++G V++ EE +LLE Sbjct: 60 WSKIHHDSHYNEKVDVGQVELLEESELLE 88 >ref|XP_017255391.1| PREDICTED: UPF0496 protein At3g19330 [Daucus carota subsp. sativus] Length = 377 Score = 81.3 bits (199), Expect = 5e-15 Identities = 48/89 (53%), Positives = 55/89 (61%), Gaps = 2/89 (2%) Frame = -2 Query: 263 MLPCLKPHPPPT--NNYLSSPTSQGYSGENTPASSVQLSPTINLTREYTLALQTNSYSEI 90 ML CL+P P T N + SP QG S E TP SS QLSPT+NL+ Y A+QT SY EI Sbjct: 1 MLHCLRPTPLATARNLHPLSPHLQGTSDEGTPGSSDQLSPTVNLSNAYKSAVQTTSYGEI 60 Query: 89 RSTFDQDNSIDQNVEIGHVDVSEEPQLLE 3 RS DNS Q VE H+D EE Q+LE Sbjct: 61 RSKLYPDNSDLQEVESQHLDGQEEGQILE 89 >gb|EYU18084.1| hypothetical protein MIMGU_mgv1a025599mg, partial [Erythranthe guttata] Length = 304 Score = 74.7 bits (182), Expect = 7e-13 Identities = 38/64 (59%), Positives = 49/64 (76%) Frame = -2 Query: 194 YSGENTPASSVQLSPTINLTREYTLALQTNSYSEIRSTFDQDNSIDQNVEIGHVDVSEEP 15 YS +NTP SSVQLSPT+NL+RE+TLA++TNSY+EIR TFDQ + +Q V+ EE Sbjct: 1 YSADNTPTSSVQLSPTVNLSREFTLAVKTNSYNEIRKTFDQIANTEQ------VEFHEET 54 Query: 14 QLLE 3 QLL+ Sbjct: 55 QLLD 58 >ref|XP_017975120.1| PREDICTED: UPF0496 protein At3g19330 [Theobroma cacao] ref|XP_017975121.1| PREDICTED: UPF0496 protein At3g19330 [Theobroma cacao] ref|XP_017975122.1| PREDICTED: UPF0496 protein At3g19330 [Theobroma cacao] Length = 381 Score = 73.2 bits (178), Expect = 4e-12 Identities = 40/83 (48%), Positives = 52/83 (62%), Gaps = 9/83 (10%) Frame = -2 Query: 260 LPCL--KPHPPPTNNYLSS-------PTSQGYSGENTPASSVQLSPTINLTREYTLALQT 108 + CL KP PPPT+ + P SQG S E TP SS Q SPT NL+REYTLA+QT Sbjct: 1 MQCLSFKPSPPPTSPQTQTIDLNSCPPASQGDSSEGTPRSSTQPSPTFNLSREYTLAVQT 60 Query: 107 NSYSEIRSTFDQDNSIDQNVEIG 39 NSY+E+RS ++ ++ +E G Sbjct: 61 NSYNEMRSRIEERVQVEDMLENG 83 >gb|EOY02975.1| Uncharacterized protein TCM_017367 isoform 1 [Theobroma cacao] Length = 381 Score = 72.8 bits (177), Expect = 5e-12 Identities = 40/83 (48%), Positives = 52/83 (62%), Gaps = 9/83 (10%) Frame = -2 Query: 260 LPCL--KPHPPPTNNYLSS-------PTSQGYSGENTPASSVQLSPTINLTREYTLALQT 108 + CL KP PPPT+ + P SQG S E TP SS Q SPT NL+REYTLA+QT Sbjct: 1 MQCLSFKPSPPPTSPQTQTIDLNSCPPASQGDSSEGTPRSSTQPSPTFNLSREYTLAVQT 60 Query: 107 NSYSEIRSTFDQDNSIDQNVEIG 39 NSY+E+RS ++ ++ +E G Sbjct: 61 NSYNEMRSRIEERVQVEDVLENG 83 >ref|XP_021297889.1| UPF0496 protein At3g19330-like isoform X2 [Herrania umbratica] Length = 381 Score = 69.3 bits (168), Expect = 9e-11 Identities = 39/83 (46%), Positives = 50/83 (60%), Gaps = 9/83 (10%) Frame = -2 Query: 260 LPCL--KPHPPPTNNYLSS-------PTSQGYSGENTPASSVQLSPTINLTREYTLALQT 108 + CL K PPPT+ + P SQG S E TP SS Q SPT NL+REYTLA+QT Sbjct: 1 MQCLSFKSSPPPTSPQTQTIDLNSCPPASQGDSSEGTPRSSTQPSPTFNLSREYTLAVQT 60 Query: 107 NSYSEIRSTFDQDNSIDQNVEIG 39 +SY EIRS ++ ++ +E G Sbjct: 61 DSYKEIRSRIEEQVQVEDVLENG 83 >gb|KZM91905.1| hypothetical protein DCAR_020730 [Daucus carota subsp. sativus] Length = 433 Score = 68.9 bits (167), Expect = 1e-10 Identities = 37/67 (55%), Positives = 44/67 (65%) Frame = -2 Query: 203 SQGYSGENTPASSVQLSPTINLTREYTLALQTNSYSEIRSTFDQDNSIDQNVEIGHVDVS 24 ++G S E TP SS QLSPT+NL+ Y A+QT SY EIRS DNS Q VE H+D Sbjct: 79 ARGTSDEGTPGSSDQLSPTVNLSNAYKSAVQTTSYGEIRSKLYPDNSDLQEVESQHLDGQ 138 Query: 23 EEPQLLE 3 EE Q+LE Sbjct: 139 EEGQILE 145 >ref|XP_006378820.1| hypothetical protein POPTR_0010s24650g [Populus trichocarpa] gb|PNT18411.1| hypothetical protein POPTR_010G240200v3 [Populus trichocarpa] Length = 386 Score = 67.4 bits (163), Expect = 4e-10 Identities = 40/76 (52%), Positives = 49/76 (64%), Gaps = 2/76 (2%) Frame = -2 Query: 239 PPPTN-NYLSSPTSQ-GYSGENTPASSVQLSPTINLTREYTLALQTNSYSEIRSTFDQDN 66 PPPTN +Y P SQ G S + TP SS Q SPTINLTREYT+A+QTNSY+E+ S D Sbjct: 19 PPPTNGDYNCPPASQAGNSADGTPRSSTQPSPTINLTREYTIAVQTNSYNEMWSRIHND- 77 Query: 65 SIDQNVEIGHVDVSEE 18 + +E H +EE Sbjct: 78 --EAQIEEIHDHYNEE 91 >ref|XP_011024180.1| PREDICTED: UPF0496 protein At3g19330-like [Populus euphratica] Length = 386 Score = 65.5 bits (158), Expect = 2e-09 Identities = 39/82 (47%), Positives = 50/82 (60%), Gaps = 3/82 (3%) Frame = -2 Query: 242 HPPPTNN--YLSSPTSQ-GYSGENTPASSVQLSPTINLTREYTLALQTNSYSEIRSTFDQ 72 H P NN Y P SQ G S + TP SS Q SPT+NLTREYTLA+QTNSY+E+ S Sbjct: 17 HSPRPNNGDYNCPPASQAGNSADGTPRSSTQPSPTVNLTREYTLAVQTNSYNEMWSRIHY 76 Query: 71 DNSIDQNVEIGHVDVSEEPQLL 6 D + + + GH + + +LL Sbjct: 77 DETQIEEIH-GHYNEEDANRLL 97 >ref|XP_004228688.1| PREDICTED: UPF0496 protein At3g19330 isoform X1 [Solanum lycopersicum] ref|XP_004228689.1| PREDICTED: UPF0496 protein At3g19330 isoform X1 [Solanum lycopersicum] Length = 376 Score = 64.7 bits (156), Expect = 4e-09 Identities = 38/87 (43%), Positives = 52/87 (59%) Frame = -2 Query: 263 MLPCLKPHPPPTNNYLSSPTSQGYSGENTPASSVQLSPTINLTREYTLALQTNSYSEIRS 84 MLPCL+ SSP+ +G ++ ASS Q SPT+NL+R YTLA++T+SY EI S Sbjct: 1 MLPCLRQLSLTATANCSSPSLEGGVADDNIASS-QPSPTVNLSRAYTLAVKTSSYGEIWS 59 Query: 83 TFDQDNSIDQNVEIGHVDVSEEPQLLE 3 + D +VE+ V+ EEP LE Sbjct: 60 KVHHEVPSDLSVEVAQVEFQEEPLQLE 86 >gb|PHT99096.1| hypothetical protein BC332_31933 [Capsicum chinense] Length = 376 Score = 62.8 bits (151), Expect = 2e-08 Identities = 38/87 (43%), Positives = 52/87 (59%) Frame = -2 Query: 263 MLPCLKPHPPPTNNYLSSPTSQGYSGENTPASSVQLSPTINLTREYTLALQTNSYSEIRS 84 ML CL+ SSP+ +G G++ ASS Q SPT+NL+R YTLA+QT+SYSEI S Sbjct: 1 MLQCLRQLSLTGTTNCSSPSLEGGLGDDNTASS-QPSPTVNLSRAYTLAVQTSSYSEIWS 59 Query: 83 TFDQDNSIDQNVEIGHVDVSEEPQLLE 3 + D++VE+ V+ E LE Sbjct: 60 KVHYEVPSDRSVEVAEVEFQEGSLQLE 86