BLASTX nr result
ID: Rehmannia29_contig00032265
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00032265 (629 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011102313.1| transcription factor bHLH49-like isoform X2 ... 102 4e-22 ref|XP_011102214.1| transcription factor bHLH49-like isoform X2 ... 102 9e-22 ref|XP_011077884.1| transcription factor bHLH49 [Sesamum indicum] 102 9e-22 gb|PIN23228.1| hypothetical protein CDL12_04051 [Handroanthus im... 93 3e-18 emb|CBI27416.3| unnamed protein product, partial [Vitis vinifera] 92 7e-18 ref|XP_010654187.1| PREDICTED: transcription factor bHLH49 isofo... 92 7e-18 ref|XP_016448171.1| PREDICTED: transcription factor bHLH49-like ... 86 1e-17 ref|XP_019228486.1| PREDICTED: transcription factor bHLH49-like ... 88 2e-16 ref|XP_009627197.1| PREDICTED: transcription factor bHLH49-like ... 86 5e-16 gb|PIN07870.1| hypothetical protein CDL12_19562 [Handroanthus im... 80 1e-15 ref|XP_016476167.1| PREDICTED: transcription factor bHLH49-like ... 85 2e-15 ref|XP_009776786.1| PREDICTED: transcription factor bHLH49-like ... 85 2e-15 ref|XP_019149816.1| PREDICTED: transcription factor bHLH49-like ... 83 6e-15 ref|XP_019149814.1| PREDICTED: transcription factor bHLH49-like ... 83 6e-15 emb|CDP00498.1| unnamed protein product [Coffea canephora] 82 1e-14 ref|XP_019233147.1| PREDICTED: transcription factor bHLH49-like,... 82 2e-14 ref|XP_018633575.1| PREDICTED: transcription factor bHLH49-like ... 82 2e-14 gb|PIN19514.1| hypothetical protein CDL12_07814 [Handroanthus im... 80 6e-14 ref|XP_022846574.1| transcription factor bHLH49-like isoform X2 ... 79 1e-13 ref|XP_022846573.1| transcription factor bHLH49-like isoform X1 ... 79 1e-13 >ref|XP_011102313.1| transcription factor bHLH49-like isoform X2 [Sesamum indicum] Length = 421 Score = 102 bits (255), Expect = 4e-22 Identities = 46/51 (90%), Positives = 49/51 (96%) Frame = +1 Query: 1 SGGFKESTSQIPNVWEDELHNIVHMGFNSSAPVNSQDLSGSLPPGHMKAEP 153 SGGFKE TSQ PNVWEDELHN+VHMGFNSSAP+N+QDLSGSLPPGHMKAEP Sbjct: 371 SGGFKEPTSQGPNVWEDELHNVVHMGFNSSAPLNTQDLSGSLPPGHMKAEP 421 >ref|XP_011102214.1| transcription factor bHLH49-like isoform X2 [Sesamum indicum] Length = 536 Score = 102 bits (255), Expect = 9e-22 Identities = 46/51 (90%), Positives = 49/51 (96%) Frame = +1 Query: 1 SGGFKESTSQIPNVWEDELHNIVHMGFNSSAPVNSQDLSGSLPPGHMKAEP 153 SGGFKE TSQ PNVWEDELHN+VHMGFNSSAP+N+QDLSGSLPPGHMKAEP Sbjct: 486 SGGFKEPTSQGPNVWEDELHNVVHMGFNSSAPLNTQDLSGSLPPGHMKAEP 536 >ref|XP_011077884.1| transcription factor bHLH49 [Sesamum indicum] Length = 536 Score = 102 bits (255), Expect = 9e-22 Identities = 46/51 (90%), Positives = 49/51 (96%) Frame = +1 Query: 1 SGGFKESTSQIPNVWEDELHNIVHMGFNSSAPVNSQDLSGSLPPGHMKAEP 153 SGGFKE TSQ PNVWEDELHN+VHMGFNSSAP+N+QDLSGSLPPGHMKAEP Sbjct: 486 SGGFKEPTSQGPNVWEDELHNVVHMGFNSSAPLNTQDLSGSLPPGHMKAEP 536 >gb|PIN23228.1| hypothetical protein CDL12_04051 [Handroanthus impetiginosus] Length = 538 Score = 92.8 bits (229), Expect = 3e-18 Identities = 41/50 (82%), Positives = 45/50 (90%) Frame = +1 Query: 4 GGFKESTSQIPNVWEDELHNIVHMGFNSSAPVNSQDLSGSLPPGHMKAEP 153 G FKE TSQ+P VWEDELHN+VH+GFNSSAP+NSQDLSGS PP HMKAEP Sbjct: 489 GVFKEPTSQVPGVWEDELHNVVHVGFNSSAPLNSQDLSGSAPPHHMKAEP 538 >emb|CBI27416.3| unnamed protein product, partial [Vitis vinifera] Length = 496 Score = 91.7 bits (226), Expect = 7e-18 Identities = 39/50 (78%), Positives = 46/50 (92%) Frame = +1 Query: 1 SGGFKESTSQIPNVWEDELHNIVHMGFNSSAPVNSQDLSGSLPPGHMKAE 150 SGG+KES Q+PNVWEDELHN+V MGF++ AP+NSQDL+GSLPPGHMKAE Sbjct: 446 SGGYKESAPQLPNVWEDELHNVVQMGFSTGAPLNSQDLNGSLPPGHMKAE 495 >ref|XP_010654187.1| PREDICTED: transcription factor bHLH49 isoform X1 [Vitis vinifera] ref|XP_010654195.1| PREDICTED: transcription factor bHLH49 isoform X1 [Vitis vinifera] ref|XP_010654202.1| PREDICTED: transcription factor bHLH49 isoform X1 [Vitis vinifera] ref|XP_010654208.1| PREDICTED: transcription factor bHLH49 isoform X1 [Vitis vinifera] ref|XP_019076890.1| PREDICTED: transcription factor bHLH49 isoform X1 [Vitis vinifera] Length = 568 Score = 91.7 bits (226), Expect = 7e-18 Identities = 39/50 (78%), Positives = 46/50 (92%) Frame = +1 Query: 1 SGGFKESTSQIPNVWEDELHNIVHMGFNSSAPVNSQDLSGSLPPGHMKAE 150 SGG+KES Q+PNVWEDELHN+V MGF++ AP+NSQDL+GSLPPGHMKAE Sbjct: 518 SGGYKESAPQLPNVWEDELHNVVQMGFSTGAPLNSQDLNGSLPPGHMKAE 567 >ref|XP_016448171.1| PREDICTED: transcription factor bHLH49-like [Nicotiana tabacum] Length = 170 Score = 86.3 bits (212), Expect = 1e-17 Identities = 35/50 (70%), Positives = 46/50 (92%) Frame = +1 Query: 1 SGGFKESTSQIPNVWEDELHNIVHMGFNSSAPVNSQDLSGSLPPGHMKAE 150 SGG+K+ +SQ+PN+W+D+LHN+V MGFNSSAP++SQD+S SLPPG MKAE Sbjct: 120 SGGYKDPSSQVPNIWDDQLHNVVEMGFNSSAPLDSQDISSSLPPGEMKAE 169 >ref|XP_019228486.1| PREDICTED: transcription factor bHLH49-like [Nicotiana attenuata] gb|OIT30706.1| transcription factor bhlh49 [Nicotiana attenuata] Length = 541 Score = 87.8 bits (216), Expect = 2e-16 Identities = 38/51 (74%), Positives = 48/51 (94%) Frame = +1 Query: 1 SGGFKESTSQIPNVWEDELHNIVHMGFNSSAPVNSQDLSGSLPPGHMKAEP 153 SGG+K+++SQ+PN+W+D+LHN+V MGFNSSAP+NSQDLS SLPPG MKAEP Sbjct: 492 SGGYKDTSSQVPNIWDDQLHNVVEMGFNSSAPLNSQDLS-SLPPGQMKAEP 541 >ref|XP_009627197.1| PREDICTED: transcription factor bHLH49-like isoform X1 [Nicotiana tomentosiformis] ref|XP_009627204.1| PREDICTED: transcription factor bHLH49-like isoform X1 [Nicotiana tomentosiformis] Length = 543 Score = 86.3 bits (212), Expect = 5e-16 Identities = 35/50 (70%), Positives = 46/50 (92%) Frame = +1 Query: 1 SGGFKESTSQIPNVWEDELHNIVHMGFNSSAPVNSQDLSGSLPPGHMKAE 150 SGG+K+ +SQ+PN+W+D+LHN+V MGFNSSAP++SQD+S SLPPG MKAE Sbjct: 493 SGGYKDPSSQVPNIWDDQLHNVVEMGFNSSAPLDSQDISSSLPPGQMKAE 542 >gb|PIN07870.1| hypothetical protein CDL12_19562 [Handroanthus impetiginosus] Length = 127 Score = 80.1 bits (196), Expect = 1e-15 Identities = 33/50 (66%), Positives = 40/50 (80%) Frame = +1 Query: 4 GGFKESTSQIPNVWEDELHNIVHMGFNSSAPVNSQDLSGSLPPGHMKAEP 153 GGF E T Q P +W++ELHN++H FNS+A +NSQDLS LPPGHMKAEP Sbjct: 78 GGFNEPTCQTPRIWDNELHNVIHNSFNSTASLNSQDLSACLPPGHMKAEP 127 >ref|XP_016476167.1| PREDICTED: transcription factor bHLH49-like [Nicotiana tabacum] Length = 542 Score = 84.7 bits (208), Expect = 2e-15 Identities = 37/51 (72%), Positives = 47/51 (92%) Frame = +1 Query: 1 SGGFKESTSQIPNVWEDELHNIVHMGFNSSAPVNSQDLSGSLPPGHMKAEP 153 SGG+K+++SQ+PN+W+D+LHN+V M FNSSAP+NSQDLS SLPPG MKAEP Sbjct: 493 SGGYKDTSSQVPNIWDDQLHNVVEMEFNSSAPLNSQDLS-SLPPGQMKAEP 542 >ref|XP_009776786.1| PREDICTED: transcription factor bHLH49-like [Nicotiana sylvestris] Length = 542 Score = 84.7 bits (208), Expect = 2e-15 Identities = 37/51 (72%), Positives = 47/51 (92%) Frame = +1 Query: 1 SGGFKESTSQIPNVWEDELHNIVHMGFNSSAPVNSQDLSGSLPPGHMKAEP 153 SGG+K+++SQ+PN+W+D+LHN+V M FNSSAP+NSQDLS SLPPG MKAEP Sbjct: 493 SGGYKDTSSQVPNIWDDQLHNVVEMEFNSSAPLNSQDLS-SLPPGQMKAEP 542 >ref|XP_019149816.1| PREDICTED: transcription factor bHLH49-like isoform X2 [Ipomoea nil] Length = 523 Score = 83.2 bits (204), Expect = 6e-15 Identities = 36/51 (70%), Positives = 45/51 (88%) Frame = +1 Query: 1 SGGFKESTSQIPNVWEDELHNIVHMGFNSSAPVNSQDLSGSLPPGHMKAEP 153 SG FKE T Q+P++W+DELHN+V MGFN SAP++SQD+ GSLPPGHMK+EP Sbjct: 474 SGSFKEPTPQVPSMWDDELHNVVQMGFNPSAPLDSQDI-GSLPPGHMKSEP 523 >ref|XP_019149814.1| PREDICTED: transcription factor bHLH49-like isoform X1 [Ipomoea nil] Length = 543 Score = 83.2 bits (204), Expect = 6e-15 Identities = 36/51 (70%), Positives = 45/51 (88%) Frame = +1 Query: 1 SGGFKESTSQIPNVWEDELHNIVHMGFNSSAPVNSQDLSGSLPPGHMKAEP 153 SG FKE T Q+P++W+DELHN+V MGFN SAP++SQD+ GSLPPGHMK+EP Sbjct: 494 SGSFKEPTPQVPSMWDDELHNVVQMGFNPSAPLDSQDI-GSLPPGHMKSEP 543 >emb|CDP00498.1| unnamed protein product [Coffea canephora] Length = 553 Score = 82.4 bits (202), Expect = 1e-14 Identities = 36/50 (72%), Positives = 42/50 (84%) Frame = +1 Query: 1 SGGFKESTSQIPNVWEDELHNIVHMGFNSSAPVNSQDLSGSLPPGHMKAE 150 SG KE +S +PNVWEDELHNIV MG NSS P++S+D+SGSL PGHMKAE Sbjct: 503 SGNLKEPSSHVPNVWEDELHNIVQMGLNSSVPLSSEDISGSLAPGHMKAE 552 >ref|XP_019233147.1| PREDICTED: transcription factor bHLH49-like, partial [Nicotiana attenuata] Length = 518 Score = 82.0 bits (201), Expect = 2e-14 Identities = 35/50 (70%), Positives = 44/50 (88%) Frame = +1 Query: 1 SGGFKESTSQIPNVWEDELHNIVHMGFNSSAPVNSQDLSGSLPPGHMKAE 150 SGGFKES+SQ+PN+W+DELHN+V MG ++S P++SQDLSGSLP G MK E Sbjct: 468 SGGFKESSSQLPNIWDDELHNVVEMGLSTSPPLHSQDLSGSLPSGQMKEE 517 >ref|XP_018633575.1| PREDICTED: transcription factor bHLH49-like isoform X2 [Nicotiana tomentosiformis] Length = 542 Score = 81.6 bits (200), Expect = 2e-14 Identities = 35/50 (70%), Positives = 46/50 (92%) Frame = +1 Query: 1 SGGFKESTSQIPNVWEDELHNIVHMGFNSSAPVNSQDLSGSLPPGHMKAE 150 SGG+K+ +SQ+PN+W+D+LHN+V MGFNSSAP++SQD+S SLPPG MKAE Sbjct: 493 SGGYKDPSSQVPNIWDDQLHNVVEMGFNSSAPLDSQDIS-SLPPGQMKAE 541 >gb|PIN19514.1| hypothetical protein CDL12_07814 [Handroanthus impetiginosus] Length = 423 Score = 80.1 bits (196), Expect = 6e-14 Identities = 33/50 (66%), Positives = 40/50 (80%) Frame = +1 Query: 4 GGFKESTSQIPNVWEDELHNIVHMGFNSSAPVNSQDLSGSLPPGHMKAEP 153 GGF E T Q P +W++ELHN++H FNS+A +NSQDLS LPPGHMKAEP Sbjct: 374 GGFNEPTCQTPRIWDNELHNVIHNSFNSTASLNSQDLSACLPPGHMKAEP 423 >ref|XP_022846574.1| transcription factor bHLH49-like isoform X2 [Olea europaea var. sylvestris] Length = 522 Score = 79.3 bits (194), Expect = 1e-13 Identities = 35/48 (72%), Positives = 43/48 (89%) Frame = +1 Query: 10 FKESTSQIPNVWEDELHNIVHMGFNSSAPVNSQDLSGSLPPGHMKAEP 153 F+ESTSQ P++WEDELHN+V MG +SSA ++SQDLSGSLPP H+KAEP Sbjct: 475 FRESTSQAPSMWEDELHNVVQMGISSSAHLSSQDLSGSLPPRHIKAEP 522 >ref|XP_022846573.1| transcription factor bHLH49-like isoform X1 [Olea europaea var. sylvestris] Length = 525 Score = 79.3 bits (194), Expect = 1e-13 Identities = 35/48 (72%), Positives = 43/48 (89%) Frame = +1 Query: 10 FKESTSQIPNVWEDELHNIVHMGFNSSAPVNSQDLSGSLPPGHMKAEP 153 F+ESTSQ P++WEDELHN+V MG +SSA ++SQDLSGSLPP H+KAEP Sbjct: 478 FRESTSQAPSMWEDELHNVVQMGISSSAHLSSQDLSGSLPPRHIKAEP 525