BLASTX nr result
ID: Rehmannia29_contig00032252
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00032252 (556 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011097776.1| mitochondrial import inner membrane transloc... 59 5e-07 ref|XP_020554392.1| mitochondrial import inner membrane transloc... 59 5e-07 >ref|XP_011097776.1| mitochondrial import inner membrane translocase subunit TIM50-like isoform X2 [Sesamum indicum] Length = 356 Score = 59.3 bits (142), Expect = 5e-07 Identities = 31/43 (72%), Positives = 35/43 (81%) Frame = +2 Query: 389 MSALIRTHSRLYSIISRNKCRFSWSAANEPRREPIISSSILSD 517 MSA++RT +RLYSIISRN RFS ANE REPIISSSI+SD Sbjct: 1 MSAILRTRARLYSIISRNDRRFSSPVANEHPREPIISSSIISD 43 >ref|XP_020554392.1| mitochondrial import inner membrane translocase subunit TIM50-like isoform X1 [Sesamum indicum] Length = 393 Score = 59.3 bits (142), Expect = 5e-07 Identities = 31/43 (72%), Positives = 35/43 (81%) Frame = +2 Query: 389 MSALIRTHSRLYSIISRNKCRFSWSAANEPRREPIISSSILSD 517 MSA++RT +RLYSIISRN RFS ANE REPIISSSI+SD Sbjct: 1 MSAILRTRARLYSIISRNDRRFSSPVANEHPREPIISSSIISD 43