BLASTX nr result
ID: Rehmannia29_contig00032193
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00032193 (419 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012850194.1| PREDICTED: cycloartenol synthase-like isofor... 55 7e-06 ref|XP_012850192.1| PREDICTED: cycloartenol synthase-like isofor... 55 7e-06 >ref|XP_012850194.1| PREDICTED: cycloartenol synthase-like isoform X2 [Erythranthe guttata] ref|XP_012850195.1| PREDICTED: cycloartenol synthase-like isoform X2 [Erythranthe guttata] Length = 622 Score = 54.7 bits (130), Expect = 7e-06 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = +3 Query: 3 LLLSQLPSEVAGQALETDKLYDAVDLILSLQVSS 104 L+LSQLP E+AGQALE +KLYDAVDLILSLQ SS Sbjct: 359 LILSQLPYEIAGQALEQNKLYDAVDLILSLQNSS 392 >ref|XP_012850192.1| PREDICTED: cycloartenol synthase-like isoform X1 [Erythranthe guttata] ref|XP_012850193.1| PREDICTED: cycloartenol synthase-like isoform X1 [Erythranthe guttata] gb|EYU26563.1| hypothetical protein MIMGU_mgv1a001814mg [Erythranthe guttata] Length = 756 Score = 54.7 bits (130), Expect = 7e-06 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = +3 Query: 3 LLLSQLPSEVAGQALETDKLYDAVDLILSLQVSS 104 L+LSQLP E+AGQALE +KLYDAVDLILSLQ SS Sbjct: 493 LILSQLPYEIAGQALEQNKLYDAVDLILSLQNSS 526