BLASTX nr result
ID: Rehmannia29_contig00032075
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00032075 (464 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN16097.1| hypothetical protein CDL12_11253 [Handroanthus im... 64 3e-10 gb|PIN16099.1| hypothetical protein CDL12_11255 [Handroanthus im... 61 1e-09 gb|OIT36865.1| hypothetical protein A4A49_36404 [Nicotiana atten... 62 2e-09 emb|CDP00466.1| unnamed protein product [Coffea canephora] 61 4e-09 gb|PIN16098.1| hypothetical protein CDL12_11254 [Handroanthus im... 61 5e-09 gb|PHU02230.1| hypothetical protein BC332_27481 [Capsicum chinense] 59 3e-08 gb|PIN11050.1| hypothetical protein CDL12_16359 [Handroanthus im... 59 7e-08 gb|PIN11048.1| hypothetical protein CDL12_16357 [Handroanthus im... 55 6e-06 >gb|PIN16097.1| hypothetical protein CDL12_11253 [Handroanthus impetiginosus] Length = 121 Score = 64.3 bits (155), Expect = 3e-10 Identities = 27/38 (71%), Positives = 34/38 (89%) Frame = -3 Query: 411 AKMMKAPGRNSRMARRVFESNPKGYFSNLRAYPGDKHC 298 AKMMKAPGRN+RM R VFE++P+GYF NLR++PGD+ C Sbjct: 84 AKMMKAPGRNTRMRRSVFEADPRGYFQNLRSHPGDELC 121 >gb|PIN16099.1| hypothetical protein CDL12_11255 [Handroanthus impetiginosus] Length = 75 Score = 61.2 bits (147), Expect = 1e-09 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = -3 Query: 408 KMMKAPGRNSRMARRVFESNPKGYFSNLRAYPGDKHC 298 KMMKAPGRN +M RR FE +PKGYF NLR++PGDK C Sbjct: 39 KMMKAPGRNFQMPRRDFEIDPKGYFQNLRSHPGDKLC 75 >gb|OIT36865.1| hypothetical protein A4A49_36404 [Nicotiana attenuata] Length = 121 Score = 62.0 bits (149), Expect = 2e-09 Identities = 26/37 (70%), Positives = 29/37 (78%) Frame = -3 Query: 414 WAKMMKAPGRNSRMARRVFESNPKGYFSNLRAYPGDK 304 W K MKAPGRN RM R FES+P+ YF NLRAYPGD+ Sbjct: 83 WGKTMKAPGRNCRMPRNTFESDPRSYFRNLRAYPGDE 119 >emb|CDP00466.1| unnamed protein product [Coffea canephora] Length = 119 Score = 61.2 bits (147), Expect = 4e-09 Identities = 27/37 (72%), Positives = 30/37 (81%) Frame = -3 Query: 408 KMMKAPGRNSRMARRVFESNPKGYFSNLRAYPGDKHC 298 KMMKAPGRN MAR FE+NPK YF NLRA+PGD+ C Sbjct: 83 KMMKAPGRNCTMARPAFEANPKSYFRNLRAHPGDQLC 119 >gb|PIN16098.1| hypothetical protein CDL12_11254 [Handroanthus impetiginosus] Length = 131 Score = 61.2 bits (147), Expect = 5e-09 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = -3 Query: 408 KMMKAPGRNSRMARRVFESNPKGYFSNLRAYPGDKHC 298 KMMKAPGRN +M RR FE +PKGYF NLR++PGDK C Sbjct: 95 KMMKAPGRNFQMPRRDFEIDPKGYFQNLRSHPGDKLC 131 >gb|PHU02230.1| hypothetical protein BC332_27481 [Capsicum chinense] Length = 115 Score = 58.9 bits (141), Expect = 3e-08 Identities = 26/37 (70%), Positives = 30/37 (81%) Frame = -3 Query: 411 AKMMKAPGRNSRMARRVFESNPKGYFSNLRAYPGDKH 301 +KMMKAPGRN R+ R FE NP+ YF+NLRAYPGD H Sbjct: 78 SKMMKAPGRNIRIPRSGFEKNPRLYFTNLRAYPGDMH 114 >gb|PIN11050.1| hypothetical protein CDL12_16359 [Handroanthus impetiginosus] Length = 146 Score = 58.5 bits (140), Expect = 7e-08 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = -3 Query: 408 KMMKAPGRNSRMARRVFESNPKGYFSNLRAYPG 310 KMMKAPG+N RM RR FE+NPKGYF NLR++PG Sbjct: 114 KMMKAPGKNHRMPRRDFENNPKGYFQNLRSHPG 146 >gb|PIN11048.1| hypothetical protein CDL12_16357 [Handroanthus impetiginosus] Length = 243 Score = 54.7 bits (130), Expect = 6e-06 Identities = 24/35 (68%), Positives = 28/35 (80%) Frame = -3 Query: 408 KMMKAPGRNSRMARRVFESNPKGYFSNLRAYPGDK 304 KMMKAPGRN RM RR FE +PKGYF LR++PG + Sbjct: 139 KMMKAPGRNRRMPRRDFEIDPKGYFQKLRSHPGSE 173