BLASTX nr result
ID: Rehmannia29_contig00032039
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00032039 (509 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_019196371.1| PREDICTED: uncharacterized protein LOC109190... 66 2e-09 ref|XP_019157547.1| PREDICTED: uncharacterized protein LOC109154... 65 3e-09 >ref|XP_019196371.1| PREDICTED: uncharacterized protein LOC109190361 [Ipomoea nil] Length = 539 Score = 65.9 bits (159), Expect = 2e-09 Identities = 25/39 (64%), Positives = 32/39 (82%) Frame = +3 Query: 3 LCHGFLPGYVHWVWHGEVGSTHTSSPSPNIMQSNVQIEN 119 +C G +PGYVHW+WHGE GS TSS +PN++ +NVQIEN Sbjct: 44 ICDGIVPGYVHWIWHGEGGSLDTSSSTPNVVSTNVQIEN 82 >ref|XP_019157547.1| PREDICTED: uncharacterized protein LOC109154135 [Ipomoea nil] Length = 1117 Score = 65.5 bits (158), Expect = 3e-09 Identities = 25/39 (64%), Positives = 32/39 (82%) Frame = +3 Query: 3 LCHGFLPGYVHWVWHGEVGSTHTSSPSPNIMQSNVQIEN 119 +C G +PGYVHW+WHGE GS TSS +PN++ +NVQIEN Sbjct: 44 ICDGIVPGYVHWIWHGEGGSLDTSSSTPNVVPTNVQIEN 82