BLASTX nr result
ID: Rehmannia29_contig00032020
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00032020 (499 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN08046.1| hypothetical protein CDL12_19391 [Handroanthus im... 177 2e-49 ref|XP_022842097.1| two-component response regulator-like PRR37 ... 122 1e-31 ref|XP_012835976.1| PREDICTED: two-component response regulator-... 119 2e-28 gb|EYU38503.1| hypothetical protein MIMGU_mgv1a024788mg, partial... 119 3e-28 ref|XP_012835975.1| PREDICTED: two-component response regulator-... 119 3e-28 gb|KZV51770.1| hypothetical protein F511_11458 [Dorcoceras hygro... 119 3e-28 ref|XP_022856395.1| two-component response regulator-like APRR7 ... 102 2e-22 ref|XP_019254731.1| PREDICTED: two-component response regulator-... 100 2e-21 ref|XP_019254730.1| PREDICTED: two-component response regulator-... 100 2e-21 ref|XP_019254728.1| PREDICTED: two-component response regulator-... 100 2e-21 gb|PIN13302.1| hypothetical protein CDL12_14073 [Handroanthus im... 95 2e-19 ref|XP_011094752.1| two-component response regulator-like APRR3 ... 94 3e-19 ref|XP_018623694.1| PREDICTED: two-component response regulator-... 92 2e-18 ref|XP_009778569.1| PREDICTED: two-component response regulator-... 89 3e-17 ref|XP_009778568.1| PREDICTED: two-component response regulator-... 89 3e-17 ref|XP_016491669.1| PREDICTED: two-component response regulator-... 89 3e-17 gb|EYU41647.1| hypothetical protein MIMGU_mgv1a002467mg [Erythra... 86 2e-16 gb|EYU41646.1| hypothetical protein MIMGU_mgv1a002467mg [Erythra... 86 2e-16 ref|XP_012831940.1| PREDICTED: two-component response regulator-... 86 2e-16 ref|XP_016433367.1| PREDICTED: two-component response regulator-... 86 2e-16 >gb|PIN08046.1| hypothetical protein CDL12_19391 [Handroanthus impetiginosus] Length = 638 Score = 177 bits (450), Expect = 2e-49 Identities = 96/148 (64%), Positives = 110/148 (74%), Gaps = 13/148 (8%) Frame = +1 Query: 1 SQPDTVAKGKDLEKIILNNMESKSENPMKIPLTPTTGAKLKSLSNVDCNMSIKPVDK--- 171 SQPD V KGK+L+ ++ N+ESKSEN M+IP TP GAKLKSLS +DCNMS K VDK Sbjct: 308 SQPDVVVKGKNLDTVLPRNVESKSENAMEIPRTPM-GAKLKSLSELDCNMSNKQVDKGQM 366 Query: 172 ----------HKGGSAKISTPPIDGKESGSNREATSILDINNNATDDSKEPNFELSLKRL 321 +K G+AK + P ID ESGS RE TSILD+N+NA DDSKEPNFELSLKR Sbjct: 367 NAIGEYVFNKNKVGAAKTAIPLIDRTESGSAREVTSILDVNSNAADDSKEPNFELSLKRF 426 Query: 322 RGIQDAGGSVQDDRCVLRRSEQSAFSRF 405 RG+QD G S QDDRCVLRRSEQSAFSR+ Sbjct: 427 RGVQDTGRSFQDDRCVLRRSEQSAFSRY 454 >ref|XP_022842097.1| two-component response regulator-like PRR37 [Olea europaea var. sylvestris] Length = 207 Score = 122 bits (305), Expect = 1e-31 Identities = 70/149 (46%), Positives = 92/149 (61%), Gaps = 13/149 (8%) Frame = +1 Query: 10 DTVAKGKDLEKIILNNMESKSENPMKIPLTPTTGAKLKSLSNVDCNMSIKPVDK------ 171 DT+AKGK E +I N ES+SENP +I L P G + SL +DCN + VDK Sbjct: 58 DTIAKGKSFEIVIPRNSESQSENPNEIHLGPK-GTEQLSLLEIDCNTNNNRVDKGQFKTT 116 Query: 172 -------HKGGSAKISTPPIDGKESGSNREATSILDINNNATDDSKEPNFELSLKRLRGI 330 HK ++ +S+P ID + S RE +I +I N T +SK+PN ELSLKR RG+ Sbjct: 117 GECLLSKHKDVTSNMSSPWIDCRVSECTREVANISEIYNIVTHESKKPNNELSLKRFRGV 176 Query: 331 QDAGGSVQDDRCVLRRSEQSAFSRFGGRM 417 Q+ G ++QD+RC LR SEQSAFSR G R+ Sbjct: 177 QEIGRTIQDNRCYLRHSEQSAFSRLGARI 205 >ref|XP_012835976.1| PREDICTED: two-component response regulator-like APRR7 isoform X2 [Erythranthe guttata] ref|XP_012835978.1| PREDICTED: two-component response regulator-like APRR7 isoform X2 [Erythranthe guttata] ref|XP_012835979.1| PREDICTED: two-component response regulator-like APRR7 isoform X2 [Erythranthe guttata] Length = 555 Score = 119 bits (299), Expect = 2e-28 Identities = 69/143 (48%), Positives = 88/143 (61%) Frame = +1 Query: 1 SQPDTVAKGKDLEKIILNNMESKSENPMKIPLTPTTGAKLKSLSNVDCNMSIKPVDKHKG 180 SQPD +AKGKDL + N+ES L AKL S ++ MSIK + Sbjct: 176 SQPDAIAKGKDLTAALPRNVESNET------LFTPISAKLNSSLKLEHKMSIKQI----- 224 Query: 181 GSAKISTPPIDGKESGSNREATSILDINNNATDDSKEPNFELSLKRLRGIQDAGGSVQDD 360 + P + ++ GS+ + T I +INNNAT+DSKE N ELSLKRLRG+Q GGS+QDD Sbjct: 225 --VNVQRNPTE-EDKGSSAKVTGIFNINNNATNDSKELNIELSLKRLRGVQYTGGSIQDD 281 Query: 361 RCVLRRSEQSAFSRFGGRMTDTF 429 RCVLRRSEQSAFSR+ ++ F Sbjct: 282 RCVLRRSEQSAFSRYNNTSSNVF 304 >gb|EYU38503.1| hypothetical protein MIMGU_mgv1a024788mg, partial [Erythranthe guttata] Length = 605 Score = 119 bits (299), Expect = 3e-28 Identities = 69/143 (48%), Positives = 88/143 (61%) Frame = +1 Query: 1 SQPDTVAKGKDLEKIILNNMESKSENPMKIPLTPTTGAKLKSLSNVDCNMSIKPVDKHKG 180 SQPD +AKGKDL + N+ES L AKL S ++ MSIK + Sbjct: 243 SQPDAIAKGKDLTAALPRNVESNET------LFTPISAKLNSSLKLEHKMSIKQI----- 291 Query: 181 GSAKISTPPIDGKESGSNREATSILDINNNATDDSKEPNFELSLKRLRGIQDAGGSVQDD 360 + P + ++ GS+ + T I +INNNAT+DSKE N ELSLKRLRG+Q GGS+QDD Sbjct: 292 --VNVQRNPTE-EDKGSSAKVTGIFNINNNATNDSKELNIELSLKRLRGVQYTGGSIQDD 348 Query: 361 RCVLRRSEQSAFSRFGGRMTDTF 429 RCVLRRSEQSAFSR+ ++ F Sbjct: 349 RCVLRRSEQSAFSRYNNTSSNVF 371 >ref|XP_012835975.1| PREDICTED: two-component response regulator-like APRR7 isoform X1 [Erythranthe guttata] Length = 655 Score = 119 bits (299), Expect = 3e-28 Identities = 69/143 (48%), Positives = 88/143 (61%) Frame = +1 Query: 1 SQPDTVAKGKDLEKIILNNMESKSENPMKIPLTPTTGAKLKSLSNVDCNMSIKPVDKHKG 180 SQPD +AKGKDL + N+ES L AKL S ++ MSIK + Sbjct: 276 SQPDAIAKGKDLTAALPRNVESNET------LFTPISAKLNSSLKLEHKMSIKQI----- 324 Query: 181 GSAKISTPPIDGKESGSNREATSILDINNNATDDSKEPNFELSLKRLRGIQDAGGSVQDD 360 + P + ++ GS+ + T I +INNNAT+DSKE N ELSLKRLRG+Q GGS+QDD Sbjct: 325 --VNVQRNPTE-EDKGSSAKVTGIFNINNNATNDSKELNIELSLKRLRGVQYTGGSIQDD 381 Query: 361 RCVLRRSEQSAFSRFGGRMTDTF 429 RCVLRRSEQSAFSR+ ++ F Sbjct: 382 RCVLRRSEQSAFSRYNNTSSNVF 404 >gb|KZV51770.1| hypothetical protein F511_11458 [Dorcoceras hygrometricum] Length = 722 Score = 119 bits (299), Expect = 3e-28 Identities = 72/147 (48%), Positives = 92/147 (62%), Gaps = 13/147 (8%) Frame = +1 Query: 4 QPDTVAKGKDLEKIILNNMESKSENPMKIPLTPTTGAKLKSLSNVDCNMSIKPV------ 165 +P + K+L+ I + ES+S+N +K+PLT TG KSLS V+CN+ IK V Sbjct: 293 KPPDHLEDKNLKINIPRDWESQSDNSVKVPLT-LTGPNPKSLSEVNCNIIIKKVAEGRPN 351 Query: 166 -------DKHKGGSAKISTPPIDGKESGSNREATSILDINNNATDDSKEPNFELSLKRLR 324 +K +G K S P ID +ES S E + L++ NN TDDSKEP ELSLKR R Sbjct: 352 PISECLFEKREGDYEKSSKPLIDVRESESTIEVANYLNLGNNGTDDSKEPKSELSLKRHR 411 Query: 325 GIQDAGGSVQDDRCVLRRSEQSAFSRF 405 +QD G SVQDDR +LRRSEQSAFSR+ Sbjct: 412 RVQDTGRSVQDDRYILRRSEQSAFSRY 438 >ref|XP_022856395.1| two-component response regulator-like APRR7 isoform X1 [Olea europaea var. sylvestris] ref|XP_022856396.1| two-component response regulator-like APRR7 isoform X1 [Olea europaea var. sylvestris] ref|XP_022856397.1| two-component response regulator-like APRR7 isoform X1 [Olea europaea var. sylvestris] ref|XP_022856398.1| two-component response regulator-like APRR7 isoform X1 [Olea europaea var. sylvestris] ref|XP_022856399.1| two-component response regulator-like APRR7 isoform X1 [Olea europaea var. sylvestris] ref|XP_022856400.1| two-component response regulator-like APRR7 isoform X1 [Olea europaea var. sylvestris] ref|XP_022856401.1| two-component response regulator-like APRR7 isoform X1 [Olea europaea var. sylvestris] ref|XP_022856402.1| two-component response regulator-like APRR7 isoform X1 [Olea europaea var. sylvestris] ref|XP_022856403.1| two-component response regulator-like APRR7 isoform X1 [Olea europaea var. sylvestris] Length = 447 Score = 102 bits (254), Expect = 2e-22 Identities = 68/146 (46%), Positives = 84/146 (57%), Gaps = 13/146 (8%) Frame = +1 Query: 4 QPDTVAKGKDLEKIILNNMESKSENPMKIPLTPTTGAKLKSLSNVDCNMSIKPVDK---- 171 QPD +AKGKD E ++ N +S+SENP+K P + K++ D +MS K +D+ Sbjct: 312 QPDIIAKGKDQEAVVPTNSDSRSENPVKAPF------EKKTMPETDRDMSSKRIDEGQAN 365 Query: 172 ---------HKGGSAKISTPPIDGKESGSNREATSILDINNNATDDSKEPNFELSLKRLR 324 HK S K S P KES S RE + LDIN++A DDSKE SL LR Sbjct: 366 FIGECLFSNHKIVSLK-SNPLTVSKESESTREVANRLDINSDAADDSKER----SLTSLR 420 Query: 325 GIQDAGGSVQDDRCVLRRSEQSAFSR 402 G QD G +VQDD VL RSEQSAFSR Sbjct: 421 GFQDTGRTVQDDCSVLLRSEQSAFSR 446 >ref|XP_019254731.1| PREDICTED: two-component response regulator-like APRR7 isoform X3 [Nicotiana attenuata] Length = 724 Score = 100 bits (248), Expect = 2e-21 Identities = 63/154 (40%), Positives = 87/154 (56%), Gaps = 13/154 (8%) Frame = +1 Query: 4 QPDTVAKGKDLEKIILNNMESKSENPMKIPLTPTTGAKLKSLSNVDCNMSIKPVDKHKGG 183 +PD +AK K I N +S+SEN ++IP GAK KSL +D N S +DKH+ Sbjct: 320 KPDCIAKRKSSLVGIPRNQKSQSENAIQIPFK-LVGAKQKSLLEIDSNASSFKIDKHRAN 378 Query: 184 -------------SAKISTPPIDGKESGSNREATSILDINNNATDDSKEPNFELSLKRLR 324 +A+ S P D +E ++L+INN + ++SK+P FELSLKRLR Sbjct: 379 LDGNRPSTEYHDVTAETSNPRSDSRELNK-----AVLEINNASINESKQPLFELSLKRLR 433 Query: 325 GIQDAGGSVQDDRCVLRRSEQSAFSRFGGRMTDT 426 G ++ G + QDDR VLRRS+ SAFSR+ T Sbjct: 434 GPKEPGKTAQDDRNVLRRSDLSAFSRYNSSSNPT 467 >ref|XP_019254730.1| PREDICTED: two-component response regulator-like APRR7 isoform X2 [Nicotiana attenuata] gb|OIS98048.1| two-component response regulator-like aprr7 [Nicotiana attenuata] Length = 727 Score = 100 bits (248), Expect = 2e-21 Identities = 63/154 (40%), Positives = 87/154 (56%), Gaps = 13/154 (8%) Frame = +1 Query: 4 QPDTVAKGKDLEKIILNNMESKSENPMKIPLTPTTGAKLKSLSNVDCNMSIKPVDKHKGG 183 +PD +AK K I N +S+SEN ++IP GAK KSL +D N S +DKH+ Sbjct: 320 KPDCIAKRKSSLVGIPRNQKSQSENAIQIPFK-LVGAKQKSLLEIDSNASSFKIDKHRAN 378 Query: 184 -------------SAKISTPPIDGKESGSNREATSILDINNNATDDSKEPNFELSLKRLR 324 +A+ S P D +E ++L+INN + ++SK+P FELSLKRLR Sbjct: 379 LDGNRPSTEYHDVTAETSNPRSDSRELNK-----AVLEINNASINESKQPLFELSLKRLR 433 Query: 325 GIQDAGGSVQDDRCVLRRSEQSAFSRFGGRMTDT 426 G ++ G + QDDR VLRRS+ SAFSR+ T Sbjct: 434 GPKEPGKTAQDDRNVLRRSDLSAFSRYNSSSNPT 467 >ref|XP_019254728.1| PREDICTED: two-component response regulator-like APRR7 isoform X1 [Nicotiana attenuata] ref|XP_019254729.1| PREDICTED: two-component response regulator-like APRR7 isoform X1 [Nicotiana attenuata] Length = 733 Score = 100 bits (248), Expect = 2e-21 Identities = 63/154 (40%), Positives = 87/154 (56%), Gaps = 13/154 (8%) Frame = +1 Query: 4 QPDTVAKGKDLEKIILNNMESKSENPMKIPLTPTTGAKLKSLSNVDCNMSIKPVDKHKGG 183 +PD +AK K I N +S+SEN ++IP GAK KSL +D N S +DKH+ Sbjct: 320 KPDCIAKRKSSLVGIPRNQKSQSENAIQIPFK-LVGAKQKSLLEIDSNASSFKIDKHRAN 378 Query: 184 -------------SAKISTPPIDGKESGSNREATSILDINNNATDDSKEPNFELSLKRLR 324 +A+ S P D +E ++L+INN + ++SK+P FELSLKRLR Sbjct: 379 LDGNRPSTEYHDVTAETSNPRSDSRELNK-----AVLEINNASINESKQPLFELSLKRLR 433 Query: 325 GIQDAGGSVQDDRCVLRRSEQSAFSRFGGRMTDT 426 G ++ G + QDDR VLRRS+ SAFSR+ T Sbjct: 434 GPKEPGKTAQDDRNVLRRSDLSAFSRYNSSSNPT 467 >gb|PIN13302.1| hypothetical protein CDL12_14073 [Handroanthus impetiginosus] Length = 705 Score = 94.7 bits (234), Expect = 2e-19 Identities = 59/134 (44%), Positives = 72/134 (53%) Frame = +1 Query: 4 QPDTVAKGKDLEKIILNNMESKSENPMKIPLTPTTGAKLKSLSNVDCNMSIKPVDKHKGG 183 Q DTV KG DLE I N+E K ENP + Sbjct: 317 QRDTVEKGNDLETI--GNVEPKFENPAE-------------------------------- 342 Query: 184 SAKISTPPIDGKESGSNREATSILDINNNATDDSKEPNFELSLKRLRGIQDAGGSVQDDR 363 P G+ES ++ ++ LDI+N+A+DD KEPNFELSLKRLR +QD GGS QD+R Sbjct: 343 ----GQPNSTGRESEPTKDVSNKLDIDNSASDDCKEPNFELSLKRLRRVQDTGGSDQDER 398 Query: 364 CVLRRSEQSAFSRF 405 V RRSEQSAFSR+ Sbjct: 399 YVFRRSEQSAFSRY 412 >ref|XP_011094752.1| two-component response regulator-like APRR3 [Sesamum indicum] ref|XP_020553415.1| two-component response regulator-like APRR3 [Sesamum indicum] ref|XP_020553416.1| two-component response regulator-like APRR3 [Sesamum indicum] ref|XP_020553417.1| two-component response regulator-like APRR3 [Sesamum indicum] ref|XP_020553418.1| two-component response regulator-like APRR3 [Sesamum indicum] ref|XP_020553419.1| two-component response regulator-like APRR3 [Sesamum indicum] ref|XP_020553420.1| two-component response regulator-like APRR3 [Sesamum indicum] ref|XP_020553421.1| two-component response regulator-like APRR3 [Sesamum indicum] ref|XP_020553422.1| two-component response regulator-like APRR3 [Sesamum indicum] Length = 706 Score = 94.4 bits (233), Expect = 3e-19 Identities = 60/134 (44%), Positives = 70/134 (52%) Frame = +1 Query: 4 QPDTVAKGKDLEKIILNNMESKSENPMKIPLTPTTGAKLKSLSNVDCNMSIKPVDKHKGG 183 +PD KG DLE I+ N+E KSENP G Sbjct: 317 RPDDAEKGNDLETIVHKNVEPKSENPE--------------------------------G 344 Query: 184 SAKISTPPIDGKESGSNREATSILDINNNATDDSKEPNFELSLKRLRGIQDAGGSVQDDR 363 K ++ +E S RE + L+ NNATD KEPN ELSLKRLRG+QD G SV DDR Sbjct: 345 QTKPTS-----REFESTRELANKLEFCNNATDSCKEPNVELSLKRLRGVQDTGRSVPDDR 399 Query: 364 CVLRRSEQSAFSRF 405 VLRRSEQSAFSR+ Sbjct: 400 YVLRRSEQSAFSRY 413 >ref|XP_018623694.1| PREDICTED: two-component response regulator-like APRR7 isoform X1 [Nicotiana tomentosiformis] ref|XP_018623696.1| PREDICTED: two-component response regulator-like APRR7 isoform X1 [Nicotiana tomentosiformis] Length = 728 Score = 92.0 bits (227), Expect = 2e-18 Identities = 60/154 (38%), Positives = 85/154 (55%), Gaps = 13/154 (8%) Frame = +1 Query: 4 QPDTVAKGKDLEKIILNNMESKSENPMKIPLTPTTGAKLKSLSNVDCNMSIKPVDKHKGG 183 +P +AKGK I N +S+SEN ++IP AK KSL +D N S +DKH+ Sbjct: 320 KPGFIAKGKPYLIGIPRNQKSQSENAIQIPFK-LVSAKQKSLLEIDSNASSFKMDKHQAN 378 Query: 184 -------------SAKISTPPIDGKESGSNREATSILDINNNATDDSKEPNFELSLKRLR 324 +A+ + P D +E ++L+INN + ++SK+P ELSLKRLR Sbjct: 379 LDGNCPSTEYHDVTAETTHPRSDSRELNK-----AVLEINNASINESKQPVLELSLKRLR 433 Query: 325 GIQDAGGSVQDDRCVLRRSEQSAFSRFGGRMTDT 426 G ++ G + QDDR VLRRS+ SAFSR+ T Sbjct: 434 GPKEPGKAAQDDRNVLRRSDLSAFSRYNSSSNPT 467 >ref|XP_009778569.1| PREDICTED: two-component response regulator-like APRR7 isoform X2 [Nicotiana sylvestris] ref|XP_009778570.1| PREDICTED: two-component response regulator-like APRR7 isoform X2 [Nicotiana sylvestris] ref|XP_016491671.1| PREDICTED: two-component response regulator-like APRR7 isoform X3 [Nicotiana tabacum] ref|XP_016491672.1| PREDICTED: two-component response regulator-like APRR7 isoform X3 [Nicotiana tabacum] Length = 727 Score = 88.6 bits (218), Expect = 3e-17 Identities = 57/142 (40%), Positives = 81/142 (57%), Gaps = 8/142 (5%) Frame = +1 Query: 4 QPDTVAKGKDLEKIILNNMESKSENPMKIPLTPTTGAKLKSLSNVDCNMSIKPVDKHKGG 183 +PD +AKGK I N +S+SEN ++IP + GAK SL +D N S +DK++ Sbjct: 319 KPDYIAKGKPSLIGIPRNQKSQSENAIQIP-SKLVGAKQNSLLEIDSNSSSFKMDKYQAN 377 Query: 184 SAKIS--------TPPIDGKESGSNREATSILDINNNATDDSKEPNFELSLKRLRGIQDA 339 + T S S ++L+ NN + ++SK+P ELSLKRLRG ++ Sbjct: 378 LDRNCPSTEYHDVTAETSHHRSDSRELNKAVLESNNASINESKQPLLELSLKRLRGPKEP 437 Query: 340 GGSVQDDRCVLRRSEQSAFSRF 405 G + QDDR VLRRS+ SAFSR+ Sbjct: 438 GKTAQDDRNVLRRSDLSAFSRY 459 >ref|XP_009778568.1| PREDICTED: two-component response regulator-like APRR7 isoform X1 [Nicotiana sylvestris] ref|XP_016491670.1| PREDICTED: two-component response regulator-like APRR7 isoform X2 [Nicotiana tabacum] Length = 745 Score = 88.6 bits (218), Expect = 3e-17 Identities = 57/142 (40%), Positives = 81/142 (57%), Gaps = 8/142 (5%) Frame = +1 Query: 4 QPDTVAKGKDLEKIILNNMESKSENPMKIPLTPTTGAKLKSLSNVDCNMSIKPVDKHKGG 183 +PD +AKGK I N +S+SEN ++IP + GAK SL +D N S +DK++ Sbjct: 319 KPDYIAKGKPSLIGIPRNQKSQSENAIQIP-SKLVGAKQNSLLEIDSNSSSFKMDKYQAN 377 Query: 184 SAKIS--------TPPIDGKESGSNREATSILDINNNATDDSKEPNFELSLKRLRGIQDA 339 + T S S ++L+ NN + ++SK+P ELSLKRLRG ++ Sbjct: 378 LDRNCPSTEYHDVTAETSHHRSDSRELNKAVLESNNASINESKQPLLELSLKRLRGPKEP 437 Query: 340 GGSVQDDRCVLRRSEQSAFSRF 405 G + QDDR VLRRS+ SAFSR+ Sbjct: 438 GKTAQDDRNVLRRSDLSAFSRY 459 >ref|XP_016491669.1| PREDICTED: two-component response regulator-like APRR7 isoform X1 [Nicotiana tabacum] Length = 766 Score = 88.6 bits (218), Expect = 3e-17 Identities = 57/142 (40%), Positives = 81/142 (57%), Gaps = 8/142 (5%) Frame = +1 Query: 4 QPDTVAKGKDLEKIILNNMESKSENPMKIPLTPTTGAKLKSLSNVDCNMSIKPVDKHKGG 183 +PD +AKGK I N +S+SEN ++IP + GAK SL +D N S +DK++ Sbjct: 319 KPDYIAKGKPSLIGIPRNQKSQSENAIQIP-SKLVGAKQNSLLEIDSNSSSFKMDKYQAN 377 Query: 184 SAKIS--------TPPIDGKESGSNREATSILDINNNATDDSKEPNFELSLKRLRGIQDA 339 + T S S ++L+ NN + ++SK+P ELSLKRLRG ++ Sbjct: 378 LDRNCPSTEYHDVTAETSHHRSDSRELNKAVLESNNASINESKQPLLELSLKRLRGPKEP 437 Query: 340 GGSVQDDRCVLRRSEQSAFSRF 405 G + QDDR VLRRS+ SAFSR+ Sbjct: 438 GKTAQDDRNVLRRSDLSAFSRY 459 >gb|EYU41647.1| hypothetical protein MIMGU_mgv1a002467mg [Erythranthe guttata] Length = 658 Score = 86.3 bits (212), Expect = 2e-16 Identities = 57/134 (42%), Positives = 69/134 (51%), Gaps = 1/134 (0%) Frame = +1 Query: 7 PDTVAKGKDLEKIILNNMESKSENPMKIPLTPTTGAKLKSLSNVDCNMSIKPVDKHKGGS 186 PDTV +G L+ I+ +E KSE+ H G Sbjct: 303 PDTVEEGNYLDTIVNRGVELKSED-------------------------------HVEGQ 331 Query: 187 AKISTPPIDGKESGSNREATSI-LDINNNATDDSKEPNFELSLKRLRGIQDAGGSVQDDR 363 A S G+ES RE + LD+NNNA+DD EPN EL LKR+RG+QD G SV DD Sbjct: 332 ANPS-----GRESECTREVVAYKLDLNNNASDDCNEPNLELCLKRIRGVQDTGRSVLDDS 386 Query: 364 CVLRRSEQSAFSRF 405 VLRRSEQSAFSR+ Sbjct: 387 YVLRRSEQSAFSRY 400 >gb|EYU41646.1| hypothetical protein MIMGU_mgv1a002467mg [Erythranthe guttata] Length = 670 Score = 86.3 bits (212), Expect = 2e-16 Identities = 57/134 (42%), Positives = 69/134 (51%), Gaps = 1/134 (0%) Frame = +1 Query: 7 PDTVAKGKDLEKIILNNMESKSENPMKIPLTPTTGAKLKSLSNVDCNMSIKPVDKHKGGS 186 PDTV +G L+ I+ +E KSE+ H G Sbjct: 303 PDTVEEGNYLDTIVNRGVELKSED-------------------------------HVEGQ 331 Query: 187 AKISTPPIDGKESGSNREATSI-LDINNNATDDSKEPNFELSLKRLRGIQDAGGSVQDDR 363 A S G+ES RE + LD+NNNA+DD EPN EL LKR+RG+QD G SV DD Sbjct: 332 ANPS-----GRESECTREVVAYKLDLNNNASDDCNEPNLELCLKRIRGVQDTGRSVLDDS 386 Query: 364 CVLRRSEQSAFSRF 405 VLRRSEQSAFSR+ Sbjct: 387 YVLRRSEQSAFSRY 400 >ref|XP_012831940.1| PREDICTED: two-component response regulator-like APRR7 [Erythranthe guttata] Length = 686 Score = 86.3 bits (212), Expect = 2e-16 Identities = 57/134 (42%), Positives = 69/134 (51%), Gaps = 1/134 (0%) Frame = +1 Query: 7 PDTVAKGKDLEKIILNNMESKSENPMKIPLTPTTGAKLKSLSNVDCNMSIKPVDKHKGGS 186 PDTV +G L+ I+ +E KSE+ H G Sbjct: 319 PDTVEEGNYLDTIVNRGVELKSED-------------------------------HVEGQ 347 Query: 187 AKISTPPIDGKESGSNREATSI-LDINNNATDDSKEPNFELSLKRLRGIQDAGGSVQDDR 363 A S G+ES RE + LD+NNNA+DD EPN EL LKR+RG+QD G SV DD Sbjct: 348 ANPS-----GRESECTREVVAYKLDLNNNASDDCNEPNLELCLKRIRGVQDTGRSVLDDS 402 Query: 364 CVLRRSEQSAFSRF 405 VLRRSEQSAFSR+ Sbjct: 403 YVLRRSEQSAFSRY 416 >ref|XP_016433367.1| PREDICTED: two-component response regulator-like APRR7 [Nicotiana tabacum] Length = 723 Score = 85.9 bits (211), Expect = 2e-16 Identities = 55/140 (39%), Positives = 78/140 (55%), Gaps = 13/140 (9%) Frame = +1 Query: 46 ILNNMESKSENPMKIPLTPTTGAKLKSLSNVDCNMSIKPVDKHKGG-------------S 186 I N +S+SEN ++IP AK KSL +D N S +DKH+ + Sbjct: 329 IPRNQKSQSENAIQIPFK-LVSAKQKSLLEIDSNASSFKMDKHQANLDGNCPSTEYHDVT 387 Query: 187 AKISTPPIDGKESGSNREATSILDINNNATDDSKEPNFELSLKRLRGIQDAGGSVQDDRC 366 A+ + P D +E ++L+INN + ++SK+P ELSLKRLRG ++ G + QDDR Sbjct: 388 AETTHPRSDSRELNK-----AVLEINNASINESKQPVLELSLKRLRGPKEPGKAAQDDRN 442 Query: 367 VLRRSEQSAFSRFGGRMTDT 426 VLRRS+ SAFSR+ T Sbjct: 443 VLRRSDLSAFSRYNSSSNPT 462