BLASTX nr result
ID: Rehmannia29_contig00031797
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00031797 (477 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN19520.1| hypothetical protein CDL12_07794 [Handroanthus im... 55 8e-06 >gb|PIN19520.1| hypothetical protein CDL12_07794 [Handroanthus impetiginosus] Length = 369 Score = 55.1 bits (131), Expect = 8e-06 Identities = 22/30 (73%), Positives = 25/30 (83%) Frame = +2 Query: 2 VPRSGKLAVVGGSCDGDGCIWELGEDDDVW 91 VPR+GKLAVVGG C GD +WELGED+D W Sbjct: 250 VPRNGKLAVVGGICGGDAAVWELGEDEDQW 279