BLASTX nr result
ID: Rehmannia29_contig00031710
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00031710 (474 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN25600.1| hypothetical protein CDL12_01650 [Handroanthus im... 57 1e-07 gb|PIN08623.1| hypothetical protein CDL12_18798 [Handroanthus im... 57 2e-07 gb|OIT24463.1| hypothetical protein A4A49_49658 [Nicotiana atten... 54 3e-06 gb|PIN08209.1| hypothetical protein CDL12_19218 [Handroanthus im... 52 7e-06 gb|PIM97855.1| hypothetical protein CDL12_29670 [Handroanthus im... 52 7e-06 gb|PLY67097.1| hypothetical protein LSAT_5X146741 [Lactuca sativa] 52 8e-06 >gb|PIN25600.1| hypothetical protein CDL12_01650 [Handroanthus impetiginosus] Length = 110 Score = 57.0 bits (136), Expect = 1e-07 Identities = 30/39 (76%), Positives = 33/39 (84%), Gaps = 2/39 (5%) Frame = +2 Query: 362 KMWWAVS--CKSKKNSMIRKESRMEIEEILKMKLETIKE 472 KMWW V C+SKKN M R+ESRM+IEEILKMKLETIKE Sbjct: 7 KMWWKVRVPCRSKKNLM-RRESRMDIEEILKMKLETIKE 44 >gb|PIN08623.1| hypothetical protein CDL12_18798 [Handroanthus impetiginosus] Length = 115 Score = 57.0 bits (136), Expect = 2e-07 Identities = 30/39 (76%), Positives = 33/39 (84%), Gaps = 2/39 (5%) Frame = +2 Query: 362 KMWW--AVSCKSKKNSMIRKESRMEIEEILKMKLETIKE 472 KMWW V C+SKKN M R+ESRM+IEEILKMKLETIKE Sbjct: 7 KMWWNVRVPCRSKKNLM-RRESRMDIEEILKMKLETIKE 44 >gb|OIT24463.1| hypothetical protein A4A49_49658 [Nicotiana attenuata] Length = 109 Score = 53.5 bits (127), Expect = 3e-06 Identities = 26/37 (70%), Positives = 30/37 (81%) Frame = +2 Query: 362 KMWWAVSCKSKKNSMIRKESRMEIEEILKMKLETIKE 472 KMWW V C S+K+ M ESRM+IEEILKMKL+TIKE Sbjct: 7 KMWWVVPCTSRKSLMT--ESRMDIEEILKMKLDTIKE 41 >gb|PIN08209.1| hypothetical protein CDL12_19218 [Handroanthus impetiginosus] Length = 93 Score = 52.0 bits (123), Expect = 7e-06 Identities = 23/37 (62%), Positives = 31/37 (83%) Frame = +2 Query: 362 KMWWAVSCKSKKNSMIRKESRMEIEEILKMKLETIKE 472 +MWW V C+SKK+ +++ES M+I+EIL MKLETIKE Sbjct: 7 RMWWVVPCRSKKS--LKRESSMDIQEILNMKLETIKE 41 >gb|PIM97855.1| hypothetical protein CDL12_29670 [Handroanthus impetiginosus] Length = 93 Score = 52.0 bits (123), Expect = 7e-06 Identities = 23/37 (62%), Positives = 31/37 (83%) Frame = +2 Query: 362 KMWWAVSCKSKKNSMIRKESRMEIEEILKMKLETIKE 472 +MWW V C+SKK+ +++ES M+I+EIL MKLETIKE Sbjct: 7 RMWWVVPCRSKKS--LKRESSMDIQEILNMKLETIKE 41 >gb|PLY67097.1| hypothetical protein LSAT_5X146741 [Lactuca sativa] Length = 110 Score = 52.4 bits (124), Expect = 8e-06 Identities = 24/37 (64%), Positives = 31/37 (83%) Frame = +2 Query: 362 KMWWAVSCKSKKNSMIRKESRMEIEEILKMKLETIKE 472 KMWW V C+SK++ ++ ESRM+IE+ILK KLETIKE Sbjct: 7 KMWWVVPCRSKRS--LQTESRMDIEQILKAKLETIKE 41