BLASTX nr result
ID: Rehmannia29_contig00031632
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00031632 (517 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KZV51156.1| hypothetical protein F511_06220 [Dorcoceras hygro... 85 1e-18 gb|KZV38776.1| hypothetical protein F511_27129 [Dorcoceras hygro... 84 2e-18 gb|KZT76524.1| hypothetical protein F511_46453 [Dorcoceras hygro... 84 2e-18 ref|XP_012839109.1| PREDICTED: uncharacterized protein LOC105959... 86 2e-18 gb|KZV20409.1| hypothetical protein F511_30639 [Dorcoceras hygro... 84 3e-18 ref|XP_012852903.1| PREDICTED: uncharacterized protein LOC105972... 89 3e-17 ref|XP_012842091.1| PREDICTED: uncharacterized protein LOC105962... 85 9e-17 ref|XP_012847487.1| PREDICTED: uncharacterized protein LOC105967... 87 9e-17 ref|XP_012833285.1| PREDICTED: uncharacterized protein LOC105954... 87 9e-17 ref|XP_012852627.1| PREDICTED: uncharacterized protein LOC105972... 87 2e-16 ref|XP_012846942.1| PREDICTED: uncharacterized protein LOC105966... 87 2e-16 ref|XP_012828650.1| PREDICTED: uncharacterized protein LOC105949... 87 2e-16 ref|XP_019447233.1| PREDICTED: uncharacterized protein K02A2.6-l... 81 2e-16 ref|XP_012840482.1| PREDICTED: uncharacterized protein LOC105960... 86 2e-16 ref|XP_012834007.1| PREDICTED: uncharacterized protein LOC105954... 86 2e-16 ref|XP_012853001.1| PREDICTED: uncharacterized protein LOC105972... 86 3e-16 ref|XP_012829078.1| PREDICTED: uncharacterized protein LOC105950... 86 3e-16 ref|XP_012833063.1| PREDICTED: uncharacterized protein LOC105953... 86 3e-16 ref|XP_012849469.1| PREDICTED: uncharacterized protein LOC105969... 86 4e-16 ref|XP_012833298.1| PREDICTED: uncharacterized protein LOC105954... 86 4e-16 >gb|KZV51156.1| hypothetical protein F511_06220 [Dorcoceras hygrometricum] Length = 76 Score = 85.1 bits (209), Expect = 1e-18 Identities = 37/63 (58%), Positives = 49/63 (77%) Frame = +3 Query: 96 FQVGDLVLRRADASKNKGKLDPNWEGPLRVIKVLVGGAYKLEELNGKKLHRAWNVSNLKK 275 FQVGDLVLRRAD K KLDP WEGP +V++++ G Y+L+ ++GK L R WNV+NLKK Sbjct: 14 FQVGDLVLRRADILKPVAKLDPKWEGPYKVVEIVKAGTYRLQNVDGKILPRPWNVANLKK 73 Query: 276 YYS 284 +Y+ Sbjct: 74 FYA 76 >gb|KZV38776.1| hypothetical protein F511_27129 [Dorcoceras hygrometricum] Length = 76 Score = 84.3 bits (207), Expect = 2e-18 Identities = 37/63 (58%), Positives = 48/63 (76%) Frame = +3 Query: 96 FQVGDLVLRRADASKNKGKLDPNWEGPLRVIKVLVGGAYKLEELNGKKLHRAWNVSNLKK 275 FQVGDLVLRRAD K KLDP WEGP +V++++ G Y+L+ + GK L R WNV+NLKK Sbjct: 14 FQVGDLVLRRADILKPVAKLDPKWEGPYKVVEIVKAGTYRLQNIYGKILPRPWNVANLKK 73 Query: 276 YYS 284 +Y+ Sbjct: 74 FYA 76 >gb|KZT76524.1| hypothetical protein F511_46453 [Dorcoceras hygrometricum] Length = 76 Score = 84.3 bits (207), Expect = 2e-18 Identities = 37/63 (58%), Positives = 48/63 (76%) Frame = +3 Query: 96 FQVGDLVLRRADASKNKGKLDPNWEGPLRVIKVLVGGAYKLEELNGKKLHRAWNVSNLKK 275 FQVGDLVLRRAD K KLDP WEGP +V++++ G Y+L+ L+G L R WNV+NLKK Sbjct: 14 FQVGDLVLRRADILKQVTKLDPKWEGPYKVVEIVKAGTYRLQNLDGNILPRPWNVANLKK 73 Query: 276 YYS 284 +Y+ Sbjct: 74 FYA 76 >ref|XP_012839109.1| PREDICTED: uncharacterized protein LOC105959536 [Erythranthe guttata] Length = 118 Score = 85.5 bits (210), Expect = 2e-18 Identities = 38/63 (60%), Positives = 49/63 (77%) Frame = +3 Query: 96 FQVGDLVLRRADASKNKGKLDPNWEGPLRVIKVLVGGAYKLEELNGKKLHRAWNVSNLKK 275 FQ+GDLVLRRADA K+ GKL+ NWEGP V K L GG Y+L ++ GK L RAWNV +LK+ Sbjct: 56 FQIGDLVLRRADALKHTGKLEANWEGPYMVTKCLAGGGYELADVEGKPLPRAWNVIHLKR 115 Query: 276 YYS 284 +++ Sbjct: 116 FFA 118 >gb|KZV20409.1| hypothetical protein F511_30639 [Dorcoceras hygrometricum] Length = 76 Score = 84.0 bits (206), Expect = 3e-18 Identities = 36/63 (57%), Positives = 49/63 (77%) Frame = +3 Query: 96 FQVGDLVLRRADASKNKGKLDPNWEGPLRVIKVLVGGAYKLEELNGKKLHRAWNVSNLKK 275 FQVGDLVLRRAD K KLDP WEGP +V++++ G Y+L+ ++GK L R WNV+NL+K Sbjct: 14 FQVGDLVLRRADILKQVAKLDPKWEGPYKVVEIVKTGTYRLQNVDGKILPRPWNVANLRK 73 Query: 276 YYS 284 +Y+ Sbjct: 74 FYA 76 >ref|XP_012852903.1| PREDICTED: uncharacterized protein LOC105972487 [Erythranthe guttata] Length = 940 Score = 88.6 bits (218), Expect = 3e-17 Identities = 38/63 (60%), Positives = 50/63 (79%) Frame = +3 Query: 96 FQVGDLVLRRADASKNKGKLDPNWEGPLRVIKVLVGGAYKLEELNGKKLHRAWNVSNLKK 275 FQ+GDLVLRRADA KN GKL+ NWEGP V K L GG Y+L ++ GK L RAWN+++LK+ Sbjct: 878 FQIGDLVLRRADALKNTGKLEANWEGPYTVAKCLAGGGYELTDMEGKALPRAWNIAHLKR 937 Query: 276 YYS 284 +++ Sbjct: 938 FFA 940 >ref|XP_012842091.1| PREDICTED: uncharacterized protein LOC105962340 [Erythranthe guttata] Length = 248 Score = 84.7 bits (208), Expect = 9e-17 Identities = 35/63 (55%), Positives = 50/63 (79%) Frame = +3 Query: 96 FQVGDLVLRRADASKNKGKLDPNWEGPLRVIKVLVGGAYKLEELNGKKLHRAWNVSNLKK 275 FQVGDLVLR+A+AS+ GKLDP WEGP ++ +V+ GAY+LE ++G + R WN+ NLK+ Sbjct: 186 FQVGDLVLRKAEASRPIGKLDPKWEGPYKITQVVNSGAYRLENIDGHPIPRTWNIGNLKR 245 Query: 276 YYS 284 +Y+ Sbjct: 246 FYA 248 >ref|XP_012847487.1| PREDICTED: uncharacterized protein LOC105967439 [Erythranthe guttata] Length = 1744 Score = 87.4 bits (215), Expect = 9e-17 Identities = 40/63 (63%), Positives = 49/63 (77%) Frame = +3 Query: 96 FQVGDLVLRRADASKNKGKLDPNWEGPLRVIKVLVGGAYKLEELNGKKLHRAWNVSNLKK 275 FQVGDLVL++ADA K GK++PNWEGP V K+L GGAY+L NG KL R WNV +LKK Sbjct: 1682 FQVGDLVLKQADALKATGKMEPNWEGPYIVKKILKGGAYELATANGSKLPRPWNVGHLKK 1741 Query: 276 YYS 284 Y++ Sbjct: 1742 YFA 1744 >ref|XP_012833285.1| PREDICTED: uncharacterized protein LOC105954155 [Erythranthe guttata] Length = 1744 Score = 87.4 bits (215), Expect = 9e-17 Identities = 40/63 (63%), Positives = 49/63 (77%) Frame = +3 Query: 96 FQVGDLVLRRADASKNKGKLDPNWEGPLRVIKVLVGGAYKLEELNGKKLHRAWNVSNLKK 275 FQVGDLVL++ADA K GK++PNWEGP V K+L GGAY+L NG KL R WNV +LKK Sbjct: 1682 FQVGDLVLKQADALKATGKMEPNWEGPYIVKKILKGGAYELATANGSKLPRPWNVGHLKK 1741 Query: 276 YYS 284 Y++ Sbjct: 1742 YFA 1744 >ref|XP_012852627.1| PREDICTED: uncharacterized protein LOC105972238 [Erythranthe guttata] Length = 1207 Score = 86.7 bits (213), Expect = 2e-16 Identities = 38/63 (60%), Positives = 49/63 (77%) Frame = +3 Query: 96 FQVGDLVLRRADASKNKGKLDPNWEGPLRVIKVLVGGAYKLEELNGKKLHRAWNVSNLKK 275 FQVGDLVL++ADA K GK++PNWEGP + K+L GGAY+L NG KL R WN+ +LKK Sbjct: 1145 FQVGDLVLKQADALKATGKMEPNWEGPYIIKKILKGGAYELATANGSKLPRPWNIGHLKK 1204 Query: 276 YYS 284 Y++ Sbjct: 1205 YFA 1207 >ref|XP_012846942.1| PREDICTED: uncharacterized protein LOC105966912 [Erythranthe guttata] Length = 1732 Score = 86.7 bits (213), Expect = 2e-16 Identities = 39/62 (62%), Positives = 49/62 (79%) Frame = +3 Query: 96 FQVGDLVLRRADASKNKGKLDPNWEGPLRVIKVLVGGAYKLEELNGKKLHRAWNVSNLKK 275 FQVGDLVL++ADA K GKL WEGP +V+ VL GGAY LE++NG ++ RAWNV +LK+ Sbjct: 1670 FQVGDLVLKQADALKMVGKLMEKWEGPYKVVAVLAGGAYMLEDMNGLRISRAWNVCHLKR 1729 Query: 276 YY 281 YY Sbjct: 1730 YY 1731 >ref|XP_012828650.1| PREDICTED: uncharacterized protein LOC105949892 [Erythranthe guttata] Length = 1746 Score = 86.7 bits (213), Expect = 2e-16 Identities = 38/63 (60%), Positives = 49/63 (77%) Frame = +3 Query: 96 FQVGDLVLRRADASKNKGKLDPNWEGPLRVIKVLVGGAYKLEELNGKKLHRAWNVSNLKK 275 FQVGDLVL++ADA K GK++PNWEGP + K+L GGAY+L NG KL R WN+ +LKK Sbjct: 1684 FQVGDLVLKQADALKATGKMEPNWEGPYIIKKILKGGAYELATANGSKLPRPWNIGHLKK 1743 Query: 276 YYS 284 Y++ Sbjct: 1744 YFA 1746 >ref|XP_019447233.1| PREDICTED: uncharacterized protein K02A2.6-like [Lupinus angustifolius] Length = 248 Score = 80.9 bits (198), Expect(2) = 2e-16 Identities = 37/63 (58%), Positives = 47/63 (74%) Frame = +3 Query: 96 FQVGDLVLRRADASKNKGKLDPNWEGPLRVIKVLVGGAYKLEELNGKKLHRAWNVSNLKK 275 F G LVLRRAD + +GKL PNWEGP RVIK + GAYKL++L GK + R WNV+NL+ Sbjct: 186 FPEGTLVLRRADIGRVRGKLGPNWEGPYRVIKKIGKGAYKLQDLAGKNIPRTWNVANLRI 245 Query: 276 YYS 284 +Y+ Sbjct: 246 FYA 248 Score = 32.3 bits (72), Expect(2) = 2e-16 Identities = 11/28 (39%), Positives = 20/28 (71%) Frame = +2 Query: 5 NGQVEVINRILVQGLKTRLERAGGAWVQ 88 NGQ E N+++++G+K RL+ + WV+ Sbjct: 136 NGQAEAANKVILKGIKKRLDESKANWVR 163 >ref|XP_012840482.1| PREDICTED: uncharacterized protein LOC105960816 [Erythranthe guttata] Length = 1677 Score = 86.3 bits (212), Expect = 2e-16 Identities = 37/62 (59%), Positives = 49/62 (79%) Frame = +3 Query: 96 FQVGDLVLRRADASKNKGKLDPNWEGPLRVIKVLVGGAYKLEELNGKKLHRAWNVSNLKK 275 FQ+GDLVLRRADA K+ GKL+ NWEGP V + L GG Y+L ++NGK L RAWN+ +LK+ Sbjct: 1615 FQIGDLVLRRADALKHTGKLEANWEGPYTVTRCLAGGGYELADINGKPLPRAWNIIHLKR 1674 Query: 276 YY 281 ++ Sbjct: 1675 FF 1676 >ref|XP_012834007.1| PREDICTED: uncharacterized protein LOC105954870 [Erythranthe guttata] Length = 1718 Score = 86.3 bits (212), Expect = 2e-16 Identities = 37/63 (58%), Positives = 49/63 (77%) Frame = +3 Query: 96 FQVGDLVLRRADASKNKGKLDPNWEGPLRVIKVLVGGAYKLEELNGKKLHRAWNVSNLKK 275 FQVGDLVLR+A+AS GKLDP WEGP ++ KV+ GAY+LE +NG + R WN+ NLK+ Sbjct: 1604 FQVGDLVLRKAEASHPIGKLDPKWEGPYKITKVVNTGAYRLENINGHPIPRTWNIGNLKR 1663 Query: 276 YYS 284 +Y+ Sbjct: 1664 FYA 1666 >ref|XP_012853001.1| PREDICTED: uncharacterized protein LOC105972583 [Erythranthe guttata] Length = 806 Score = 85.9 bits (211), Expect = 3e-16 Identities = 38/62 (61%), Positives = 48/62 (77%) Frame = +3 Query: 96 FQVGDLVLRRADASKNKGKLDPNWEGPLRVIKVLVGGAYKLEELNGKKLHRAWNVSNLKK 275 FQVGDLVL++ADA K GKL WEGP +V+ VL GGAY LE++ G ++ RAWNV +LK+ Sbjct: 744 FQVGDLVLKQADALKTVGKLMEKWEGPYKVVAVLAGGAYMLEDMKGSRISRAWNVCHLKR 803 Query: 276 YY 281 YY Sbjct: 804 YY 805 >ref|XP_012829078.1| PREDICTED: uncharacterized protein LOC105950272 [Erythranthe guttata] Length = 1767 Score = 85.9 bits (211), Expect = 3e-16 Identities = 36/63 (57%), Positives = 50/63 (79%) Frame = +3 Query: 96 FQVGDLVLRRADASKNKGKLDPNWEGPLRVIKVLVGGAYKLEELNGKKLHRAWNVSNLKK 275 FQVGDLVLR+A+AS+ GKLDP WEGP ++ +V+ GAY+LE L+G + R WN+ NLK+ Sbjct: 1705 FQVGDLVLRKAEASRPIGKLDPKWEGPYKITQVINNGAYRLENLDGHPIPRTWNIGNLKR 1764 Query: 276 YYS 284 +Y+ Sbjct: 1765 FYA 1767 >ref|XP_012833063.1| PREDICTED: uncharacterized protein LOC105953927 [Erythranthe guttata] Length = 1786 Score = 85.9 bits (211), Expect = 3e-16 Identities = 37/63 (58%), Positives = 50/63 (79%) Frame = +3 Query: 96 FQVGDLVLRRADASKNKGKLDPNWEGPLRVIKVLVGGAYKLEELNGKKLHRAWNVSNLKK 275 FQ+GDLVLRRADA K+ GKL+ NWEGP V K L GG Y+L +++GK L RAWN+ +LK+ Sbjct: 1724 FQIGDLVLRRADALKHTGKLEANWEGPYTVTKCLAGGGYELADIDGKPLPRAWNIIHLKR 1783 Query: 276 YYS 284 +++ Sbjct: 1784 FFA 1786 >ref|XP_012849469.1| PREDICTED: uncharacterized protein LOC105969267 [Erythranthe guttata] Length = 829 Score = 85.5 bits (210), Expect = 4e-16 Identities = 36/63 (57%), Positives = 50/63 (79%) Frame = +3 Query: 96 FQVGDLVLRRADASKNKGKLDPNWEGPLRVIKVLVGGAYKLEELNGKKLHRAWNVSNLKK 275 FQVGDLVLR+A+AS GKLDP WEGP ++ KV+ GAY+LE ++G+ + R WN+ NLK+ Sbjct: 767 FQVGDLVLRKAEASHPIGKLDPKWEGPYKITKVVNTGAYRLENIDGRPIPRTWNIGNLKR 826 Query: 276 YYS 284 +Y+ Sbjct: 827 FYA 829 >ref|XP_012833298.1| PREDICTED: uncharacterized protein LOC105954166 [Erythranthe guttata] Length = 1092 Score = 85.5 bits (210), Expect = 4e-16 Identities = 36/63 (57%), Positives = 50/63 (79%) Frame = +3 Query: 96 FQVGDLVLRRADASKNKGKLDPNWEGPLRVIKVLVGGAYKLEELNGKKLHRAWNVSNLKK 275 FQVGDLVLR+A+AS GKLDP WEGP ++ KV+ GAY+LE ++G+ + R WN+ NLK+ Sbjct: 1030 FQVGDLVLRKAEASHPIGKLDPKWEGPYKITKVVNTGAYRLENIDGRPIPRTWNIGNLKR 1089 Query: 276 YYS 284 +Y+ Sbjct: 1090 FYA 1092