BLASTX nr result
ID: Rehmannia29_contig00031603
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00031603 (422 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN21352.1| hypothetical protein CDL12_05937 [Handroanthus im... 70 2e-12 ref|XP_012846758.1| PREDICTED: uncharacterized protein LOC105966... 71 3e-12 ref|XP_011082919.1| uncharacterized protein LOC105165561 [Sesamu... 69 7e-12 >gb|PIN21352.1| hypothetical protein CDL12_05937 [Handroanthus impetiginosus] Length = 154 Score = 70.1 bits (170), Expect = 2e-12 Identities = 40/60 (66%), Positives = 44/60 (73%), Gaps = 2/60 (3%) Frame = -1 Query: 422 VGETSEAVKSKSAETEEAGLDENPRSTHTQ--PFVAMNASSRASWMNCCGLLDVLRPSDQ 249 V E+ E V AE AGL+EN RSTHTQ PFVA+ AS+ ASWMNCCGLLDV RPSDQ Sbjct: 99 VRESHETV----AEQGIAGLEENSRSTHTQGQPFVAVIASTWASWMNCCGLLDVPRPSDQ 154 >ref|XP_012846758.1| PREDICTED: uncharacterized protein LOC105966719 [Erythranthe guttata] gb|EYU29582.1| hypothetical protein MIMGU_mgv1a014125mg [Erythranthe guttata] Length = 200 Score = 70.9 bits (172), Expect = 3e-12 Identities = 35/65 (53%), Positives = 48/65 (73%), Gaps = 7/65 (10%) Frame = -1 Query: 422 VGETSEAVKSKSAETEEAG----LDENPRSTHTQPFVAM---NASSRASWMNCCGLLDVL 264 VG++S+A +KS E+ G +DENPR+TH QP A+ +A+S ASWMNCCGLL++L Sbjct: 136 VGDSSDAAANKSTSAEKNGEEDCVDENPRATHGQPLAAVAATSATSPASWMNCCGLLELL 195 Query: 263 RPSDQ 249 RPSD+ Sbjct: 196 RPSDK 200 >ref|XP_011082919.1| uncharacterized protein LOC105165561 [Sesamum indicum] ref|XP_011082920.1| uncharacterized protein LOC105165561 [Sesamum indicum] Length = 161 Score = 68.9 bits (167), Expect = 7e-12 Identities = 34/58 (58%), Positives = 41/58 (70%) Frame = -1 Query: 422 VGETSEAVKSKSAETEEAGLDENPRSTHTQPFVAMNASSRASWMNCCGLLDVLRPSDQ 249 VGE+SE VKS S EA D H++PFV + +++ASWMNCCGLLDVLRPSDQ Sbjct: 107 VGESSEDVKSVS---REAAADSKEAEMHSRPFVDVTTATQASWMNCCGLLDVLRPSDQ 161