BLASTX nr result
ID: Rehmannia29_contig00031549
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00031549 (524 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN03867.1| hypothetical protein CDL12_23609 [Handroanthus im... 59 1e-07 ref|XP_011077927.1| pre-rRNA-processing protein TSR2-like [Sesam... 60 1e-07 gb|KZV47537.1| hypothetical protein F511_32791 [Dorcoceras hygro... 58 5e-07 gb|PIN19495.1| hypothetical protein CDL12_07826 [Handroanthus im... 57 6e-07 >gb|PIN03867.1| hypothetical protein CDL12_23609 [Handroanthus impetiginosus] Length = 197 Score = 59.3 bits (142), Expect = 1e-07 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -1 Query: 260 EQVYIDDVEDMLDEFMLSLNTEIGNGSMEEV 168 EQVYIDDVEDMLDEFMLS NTEIG+GS+EE+ Sbjct: 60 EQVYIDDVEDMLDEFMLSFNTEIGDGSIEEI 90 >ref|XP_011077927.1| pre-rRNA-processing protein TSR2-like [Sesamum indicum] Length = 229 Score = 59.7 bits (143), Expect = 1e-07 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = -1 Query: 260 EQVYIDDVEDMLDEFMLSLNTEIGNGSMEEV 168 EQVYIDD+EDMLDEFMLSLNTEIG+GS+EE+ Sbjct: 60 EQVYIDDLEDMLDEFMLSLNTEIGDGSIEEI 90 >gb|KZV47537.1| hypothetical protein F511_32791 [Dorcoceras hygrometricum] Length = 198 Score = 57.8 bits (138), Expect = 5e-07 Identities = 26/30 (86%), Positives = 30/30 (100%) Frame = -1 Query: 257 QVYIDDVEDMLDEFMLSLNTEIGNGSMEEV 168 QVYIDD+EDMLDEFMLSLNTEIG+GS+EE+ Sbjct: 61 QVYIDDLEDMLDEFMLSLNTEIGDGSIEEI 90 >gb|PIN19495.1| hypothetical protein CDL12_07826 [Handroanthus impetiginosus] Length = 195 Score = 57.4 bits (137), Expect = 6e-07 Identities = 35/72 (48%), Positives = 47/72 (65%), Gaps = 4/72 (5%) Frame = -1 Query: 260 EQVYIDDVEDMLDEFMLSLNTEIGNGSMEE-VCPLGIFKLNFRYQHMFV---CYAFMLYM 93 EQVYIDDVEDMLDEFMLSLN EI +GS+EE + IF + ++Y + V + F + Sbjct: 60 EQVYIDDVEDMLDEFMLSLNAEIDDGSIEEFILQAMIFIVIYKYYYFCVPKNVFTFPRCV 119 Query: 92 LPTIVKTLNLLI 57 P + L+LL+ Sbjct: 120 GPWLRLLLSLLL 131