BLASTX nr result
ID: Rehmannia29_contig00031279
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00031279 (529 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN01906.1| putative metal-binding protein [Handroanthus impe... 80 3e-14 gb|KJB52354.1| hypothetical protein B456_008G257700 [Gossypium r... 79 3e-14 gb|KZV40919.1| hypothetical protein F511_05164 [Dorcoceras hygro... 78 1e-13 ref|XP_020547157.1| UPF0160 protein MYG1, mitochondrial isoform ... 76 3e-13 emb|CBI34574.3| unnamed protein product, partial [Vitis vinifera] 75 7e-13 ref|XP_002280827.1| PREDICTED: UPF0160 protein [Vitis vinifera] 75 8e-13 ref|XP_010919324.1| PREDICTED: UPF0160 protein C694.04c [Elaeis ... 74 2e-12 gb|PON92817.1| Metal-dependent protein hydrolase [Trema orientalis] 74 4e-12 ref|XP_021888155.1| UPF0160 protein isoform X2 [Carica papaya] 70 4e-12 ref|XP_008803961.1| PREDICTED: UPF0160 protein MYG1, mitochondri... 74 5e-12 gb|KJB52353.1| hypothetical protein B456_008G257700 [Gossypium r... 72 6e-12 ref|XP_010090583.1| UPF0160 protein isoform X2 [Morus notabilis]... 73 6e-12 ref|XP_024017577.1| UPF0160 protein isoform X1 [Morus notabilis] 73 6e-12 ref|XP_011101903.1| UPF0160 protein isoform X1 [Sesamum indicum] 73 7e-12 gb|PNT45624.1| hypothetical protein POPTR_003G145900v3 [Populus ... 72 8e-12 ref|XP_022849656.1| UPF0160 protein-like [Olea europaea var. syl... 72 1e-11 ref|XP_021888154.1| UPF0160 protein isoform X1 [Carica papaya] 70 1e-11 dbj|GAV68713.1| UPF0160 domain-containing protein [Cephalotus fo... 72 1e-11 gb|PPD84705.1| hypothetical protein GOBAR_DD18393 [Gossypium bar... 71 3e-11 ref|XP_009359566.1| PREDICTED: UPF0160 protein-like [Pyrus x bre... 71 3e-11 >gb|PIN01906.1| putative metal-binding protein [Handroanthus impetiginosus] Length = 364 Score = 79.7 bits (195), Expect = 3e-14 Identities = 36/39 (92%), Positives = 39/39 (100%) Frame = -1 Query: 526 VRSHARSWLPARSIVIECLEARLDVDPSGEIMVLNRFCP 410 VRSHARSWLPARSIV++CLEARL+VDPSGEIMVLNRFCP Sbjct: 228 VRSHARSWLPARSIVMQCLEARLEVDPSGEIMVLNRFCP 266 >gb|KJB52354.1| hypothetical protein B456_008G257700 [Gossypium raimondii] gb|KJB52359.1| hypothetical protein B456_008G257700 [Gossypium raimondii] Length = 298 Score = 79.0 bits (193), Expect = 3e-14 Identities = 36/61 (59%), Positives = 46/61 (75%) Frame = -1 Query: 526 VRSHARSWLPARSIVIECLEARLDVDPSGEIMVLNRFCPVSIFTSTLRNINFIYVAFLLP 347 VR HARSWLPARSIV+EC+ R D+DPSGEIMVL RFCPVS F++ L + ++ + L Sbjct: 235 VRFHARSWLPARSIVMECIAERFDIDPSGEIMVLKRFCPVSRFSNLLSSYCYVLLQLALQ 294 Query: 346 R 344 + Sbjct: 295 K 295 >gb|KZV40919.1| hypothetical protein F511_05164 [Dorcoceras hygrometricum] Length = 371 Score = 77.8 bits (190), Expect = 1e-13 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = -1 Query: 526 VRSHARSWLPARSIVIECLEARLDVDPSGEIMVLNRFCP 410 +RSHARSWLPARSIVIECL AR D+DPSGEIMVLNRFCP Sbjct: 235 IRSHARSWLPARSIVIECLAARHDIDPSGEIMVLNRFCP 273 >ref|XP_020547157.1| UPF0160 protein MYG1, mitochondrial isoform X2 [Sesamum indicum] Length = 312 Score = 76.3 bits (186), Expect = 3e-13 Identities = 38/51 (74%), Positives = 42/51 (82%) Frame = -1 Query: 526 VRSHARSWLPARSIVIECLEARLDVDPSGEIMVLNRFCPVSIFTSTLRNIN 374 VR HARSWLPARSIV++CLEARLDVD SGEIM+L+RFCP S LR IN Sbjct: 225 VRYHARSWLPARSIVMQCLEARLDVDLSGEIMILDRFCPELHNPSDLRPIN 275 >emb|CBI34574.3| unnamed protein product, partial [Vitis vinifera] Length = 338 Score = 75.5 bits (184), Expect = 7e-13 Identities = 33/39 (84%), Positives = 37/39 (94%) Frame = -1 Query: 526 VRSHARSWLPARSIVIECLEARLDVDPSGEIMVLNRFCP 410 VR HA+SWLPARSIV+ECL AR+D+DPSGEIMVLNRFCP Sbjct: 202 VRFHAKSWLPARSIVMECLAARMDIDPSGEIMVLNRFCP 240 >ref|XP_002280827.1| PREDICTED: UPF0160 protein [Vitis vinifera] Length = 361 Score = 75.5 bits (184), Expect = 8e-13 Identities = 33/39 (84%), Positives = 37/39 (94%) Frame = -1 Query: 526 VRSHARSWLPARSIVIECLEARLDVDPSGEIMVLNRFCP 410 VR HA+SWLPARSIV+ECL AR+D+DPSGEIMVLNRFCP Sbjct: 225 VRFHAKSWLPARSIVMECLAARMDIDPSGEIMVLNRFCP 263 >ref|XP_010919324.1| PREDICTED: UPF0160 protein C694.04c [Elaeis guineensis] Length = 368 Score = 74.3 bits (181), Expect = 2e-12 Identities = 34/39 (87%), Positives = 36/39 (92%) Frame = -1 Query: 526 VRSHARSWLPARSIVIECLEARLDVDPSGEIMVLNRFCP 410 VR H RSWLPARSIVIECLE+R +VDPSGEIMVLNRFCP Sbjct: 232 VRFHVRSWLPARSIVIECLESRKNVDPSGEIMVLNRFCP 270 >gb|PON92817.1| Metal-dependent protein hydrolase [Trema orientalis] Length = 344 Score = 73.6 bits (179), Expect = 4e-12 Identities = 32/39 (82%), Positives = 36/39 (92%) Frame = -1 Query: 526 VRSHARSWLPARSIVIECLEARLDVDPSGEIMVLNRFCP 410 +R HA+SWLPARSIV+ECL AR D+DPSGEIMVLNRFCP Sbjct: 208 LRFHAKSWLPARSIVLECLSARWDIDPSGEIMVLNRFCP 246 >ref|XP_021888155.1| UPF0160 protein isoform X2 [Carica papaya] Length = 140 Score = 70.1 bits (170), Expect = 4e-12 Identities = 31/39 (79%), Positives = 35/39 (89%) Frame = -1 Query: 526 VRSHARSWLPARSIVIECLEARLDVDPSGEIMVLNRFCP 410 +R HARSWLPARSIV+ECL AR D+DPSGEIMVL +FCP Sbjct: 4 LRYHARSWLPARSIVMECLAARYDLDPSGEIMVLTKFCP 42 >ref|XP_008803961.1| PREDICTED: UPF0160 protein MYG1, mitochondrial [Phoenix dactylifera] Length = 472 Score = 73.6 bits (179), Expect = 5e-12 Identities = 34/41 (82%), Positives = 39/41 (95%) Frame = -1 Query: 526 VRSHARSWLPARSIVIECLEARLDVDPSGEIMVLNRFCPVS 404 VR +ARSWLPARSIVIECLE+R +VDPSGEIMVL++FCPVS Sbjct: 232 VRFYARSWLPARSIVIECLESRQNVDPSGEIMVLSKFCPVS 272 >gb|KJB52353.1| hypothetical protein B456_008G257700 [Gossypium raimondii] Length = 280 Score = 72.4 bits (176), Expect = 6e-12 Identities = 32/40 (80%), Positives = 35/40 (87%) Frame = -1 Query: 526 VRSHARSWLPARSIVIECLEARLDVDPSGEIMVLNRFCPV 407 VR HARSWLPARSIV+EC+ R D+DPSGEIMVL RFCPV Sbjct: 235 VRFHARSWLPARSIVMECIAERFDIDPSGEIMVLKRFCPV 274 >ref|XP_010090583.1| UPF0160 protein isoform X2 [Morus notabilis] gb|EXB39942.1| hypothetical protein L484_001701 [Morus notabilis] Length = 385 Score = 73.2 bits (178), Expect = 6e-12 Identities = 32/39 (82%), Positives = 36/39 (92%) Frame = -1 Query: 526 VRSHARSWLPARSIVIECLEARLDVDPSGEIMVLNRFCP 410 +R HA+SWLPARSIV+ECL AR D+DPSGEIMVLNRFCP Sbjct: 249 LRFHAKSWLPARSIVMECLSARWDIDPSGEIMVLNRFCP 287 >ref|XP_024017577.1| UPF0160 protein isoform X1 [Morus notabilis] Length = 388 Score = 73.2 bits (178), Expect = 6e-12 Identities = 32/39 (82%), Positives = 36/39 (92%) Frame = -1 Query: 526 VRSHARSWLPARSIVIECLEARLDVDPSGEIMVLNRFCP 410 +R HA+SWLPARSIV+ECL AR D+DPSGEIMVLNRFCP Sbjct: 249 LRFHAKSWLPARSIVMECLSARWDIDPSGEIMVLNRFCP 287 >ref|XP_011101903.1| UPF0160 protein isoform X1 [Sesamum indicum] Length = 361 Score = 72.8 bits (177), Expect = 7e-12 Identities = 33/39 (84%), Positives = 37/39 (94%) Frame = -1 Query: 526 VRSHARSWLPARSIVIECLEARLDVDPSGEIMVLNRFCP 410 VR HARSWLPARSIV++CLEARLDVD SGEIM+L+RFCP Sbjct: 225 VRYHARSWLPARSIVMQCLEARLDVDLSGEIMILDRFCP 263 >gb|PNT45624.1| hypothetical protein POPTR_003G145900v3 [Populus trichocarpa] Length = 283 Score = 72.0 bits (175), Expect = 8e-12 Identities = 33/41 (80%), Positives = 35/41 (85%) Frame = -1 Query: 526 VRSHARSWLPARSIVIECLEARLDVDPSGEIMVLNRFCPVS 404 VR HA+SWLPARSIV+ECL R DVDPSGEIMVL FCPVS Sbjct: 243 VRFHAKSWLPARSIVMECLATRFDVDPSGEIMVLKTFCPVS 283 >ref|XP_022849656.1| UPF0160 protein-like [Olea europaea var. sylvestris] Length = 372 Score = 72.4 bits (176), Expect = 1e-11 Identities = 36/53 (67%), Positives = 40/53 (75%) Frame = -1 Query: 526 VRSHARSWLPARSIVIECLEARLDVDPSGEIMVLNRFCPVSIFTSTLRNINFI 368 VR HARSWLPARSIV++CL AR DVDPSGEIMVL+RFCP + L N I Sbjct: 236 VRFHARSWLPARSIVMDCLAARGDVDPSGEIMVLDRFCPWKLHLFELEEENKI 288 >ref|XP_021888154.1| UPF0160 protein isoform X1 [Carica papaya] Length = 196 Score = 70.1 bits (170), Expect = 1e-11 Identities = 31/39 (79%), Positives = 35/39 (89%) Frame = -1 Query: 526 VRSHARSWLPARSIVIECLEARLDVDPSGEIMVLNRFCP 410 +R HARSWLPARSIV+ECL AR D+DPSGEIMVL +FCP Sbjct: 60 LRYHARSWLPARSIVMECLAARYDLDPSGEIMVLTKFCP 98 >dbj|GAV68713.1| UPF0160 domain-containing protein [Cephalotus follicularis] Length = 372 Score = 72.0 bits (175), Expect = 1e-11 Identities = 32/39 (82%), Positives = 34/39 (87%) Frame = -1 Query: 526 VRSHARSWLPARSIVIECLEARLDVDPSGEIMVLNRFCP 410 VR HA+SWLPARSIV+ECL R D DPSGEIMVLNRFCP Sbjct: 236 VRFHAKSWLPARSIVMECLATRFDTDPSGEIMVLNRFCP 274 >gb|PPD84705.1| hypothetical protein GOBAR_DD18393 [Gossypium barbadense] Length = 304 Score = 70.9 bits (172), Expect = 3e-11 Identities = 31/39 (79%), Positives = 34/39 (87%) Frame = -1 Query: 526 VRSHARSWLPARSIVIECLEARLDVDPSGEIMVLNRFCP 410 VR HARSWLPARSIV+EC+ R D+DPSGEIMVL RFCP Sbjct: 168 VRFHARSWLPARSIVMECIAERFDIDPSGEIMVLKRFCP 206 >ref|XP_009359566.1| PREDICTED: UPF0160 protein-like [Pyrus x bretschneideri] Length = 362 Score = 71.2 bits (173), Expect = 3e-11 Identities = 33/39 (84%), Positives = 35/39 (89%) Frame = -1 Query: 526 VRSHARSWLPARSIVIECLEARLDVDPSGEIMVLNRFCP 410 VR HA+SWLPARSIV+ECL AR VDPSGEIMVLNRFCP Sbjct: 225 VRFHAKSWLPARSIVMECLLARWSVDPSGEIMVLNRFCP 263