BLASTX nr result
ID: Rehmannia29_contig00031216
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00031216 (427 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|WP_024095160.1| hypothetical protein [Paenibacillus larvae] ... 52 7e-06 >ref|WP_024095160.1| hypothetical protein [Paenibacillus larvae] gb|AHD07204.1| hypothetical protein ERIC2_c34740 [Paenibacillus larvae subsp. larvae DSM 25430] Length = 105 Score = 52.0 bits (123), Expect = 7e-06 Identities = 21/42 (50%), Positives = 22/42 (52%) Frame = +1 Query: 301 GTMGTWHDGKMARWVFCHHATWHDGKNMARWHFHHHATWHDG 426 G G WHDG W HH WHDG + WH HH WHDG Sbjct: 20 GWDGGWHDGHHGGWHGGHHGGWHDGHH-GGWHGGHHGGWHDG 60