BLASTX nr result
ID: Rehmannia29_contig00030967
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00030967 (412 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KZV25510.1| replication protein A 70 kDa DNA-binding subunit ... 41 2e-06 >gb|KZV25510.1| replication protein A 70 kDa DNA-binding subunit B-like [Dorcoceras hygrometricum] Length = 161 Score = 40.8 bits (94), Expect(2) = 2e-06 Identities = 18/36 (50%), Positives = 26/36 (72%) Frame = -3 Query: 197 ILTDIIGRVVSMQSAQTTQVGGKSTRFLDITLEDLE 90 +L D+IG+VV+ S Q+ + GG+ TR LDI L+D E Sbjct: 121 MLFDVIGQVVARDSPQSREFGGRETRLLDIVLQDYE 156 Score = 38.1 bits (87), Expect(2) = 2e-06 Identities = 18/42 (42%), Positives = 30/42 (71%) Frame = -2 Query: 411 IIFHGKTHMFEMFDKSYPRLMYVFKDFRELYDFQRIDDTILF 286 I F KTH+ E+FD S+P +M+ FK F ++ + + I++T+LF Sbjct: 83 INFITKTHVCEIFDDSFPSIMFDFKSFNDVKNAE-IEETMLF 123