BLASTX nr result
ID: Rehmannia29_contig00030718
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00030718 (768 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_009380673.1| hypothetical protein AEK19_MT0281 (mitochond... 80 1e-15 emb|CDP57007.1| Cytochrome b6-f complex subunit, cytochrome b6 [... 59 5e-10 gb|OIT31379.1| pistil-specific extensin-like protein [Nicotiana ... 68 3e-09 gb|KHG09936.1| hypothetical protein F383_14565 [Gossypium arboreum] 57 2e-07 >ref|YP_009380673.1| hypothetical protein AEK19_MT0281 (mitochondrion) [Utricularia reniformis] gb|ART30557.1| hypothetical protein AEK19_MT0281 (mitochondrion) [Utricularia reniformis] Length = 77 Score = 79.7 bits (195), Expect = 1e-15 Identities = 43/72 (59%), Positives = 52/72 (72%), Gaps = 4/72 (5%) Frame = -1 Query: 747 VCDLLELILLIVQRIGLSP**RWLYFVGYLFQYLEHELYELDK----EIFEL*FILNI*P 580 +CDLLELILLIVQRIGLSP RW YFVGY +YLEHELYE++ ++ I+ I P Sbjct: 1 MCDLLELILLIVQRIGLSPLYRWFYFVGYFVEYLEHELYEINSIKNYLNYDSYLIIIIRP 60 Query: 579 RVRTPKKISNYL 544 RVR K++SN L Sbjct: 61 RVRITKRMSNCL 72 >emb|CDP57007.1| Cytochrome b6-f complex subunit, cytochrome b6 [Staphylococcus aureus subsp. aureus] Length = 267 Score = 58.5 bits (140), Expect(2) = 5e-10 Identities = 29/43 (67%), Positives = 31/43 (72%) Frame = -3 Query: 169 KIESKIKKFQTFYYVSDYYFIWVFLLELYEMKVSYTVLRGGLS 41 K+ KIKKFQTFY +S WVFL ELYEMK SYTVL GG S Sbjct: 6 KLNEKIKKFQTFYSISVSANTWVFLFELYEMKFSYTVLGGGSS 48 Score = 34.3 bits (77), Expect(2) = 5e-10 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = -2 Query: 68 IYGSERGIVTYLNKVYDWFEER 3 + G TYLNKVYDWFEER Sbjct: 42 VLGGGSSWFTYLNKVYDWFEER 63 >gb|OIT31379.1| pistil-specific extensin-like protein [Nicotiana attenuata] Length = 486 Score = 67.8 bits (164), Expect = 3e-09 Identities = 32/48 (66%), Positives = 39/48 (81%) Frame = -3 Query: 160 SKIKKFQTFYYVSDYYFIWVFLLELYEMKVSYTVLRGGLSPISIKSMI 17 S++ KF+TFY +S IWVFLLELYEMKVSYTVLRGG++PISI + Sbjct: 3 SELNKFKTFYSISVATSIWVFLLELYEMKVSYTVLRGGVTPISINPRV 50 >gb|KHG09936.1| hypothetical protein F383_14565 [Gossypium arboreum] Length = 39 Score = 56.6 bits (135), Expect = 2e-07 Identities = 29/37 (78%), Positives = 32/37 (86%) Frame = +3 Query: 657 INIRRSITISIKVTDLFSVLSIESILTSHTLIFRKYR 767 + IRR TISIK+TD FSVLSI SI+TSHTLIFRKYR Sbjct: 1 MTIRRDKTISIKMTDPFSVLSIGSIITSHTLIFRKYR 37