BLASTX nr result
ID: Rehmannia29_contig00030635
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00030635 (495 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU40931.1| hypothetical protein MIMGU_mgv1a0134081mg, partia... 69 6e-12 ref|XP_012833248.1| PREDICTED: cyclin-P3-1-like isoform X1 [Eryt... 69 3e-11 gb|PIN14577.1| Cyclin [Handroanthus impetiginosus] 61 3e-08 ref|XP_009804077.1| PREDICTED: cyclin-P3-1 [Nicotiana sylvestris... 58 5e-07 ref|XP_016449146.1| PREDICTED: cyclin-P3-1-like [Nicotiana tabacum] 57 9e-07 ref|XP_009627788.1| PREDICTED: cyclin-P3-1 [Nicotiana tomentosif... 57 9e-07 ref|XP_015165174.1| PREDICTED: cyclin-P3-1 isoform X1 [Solanum t... 57 1e-06 ref|XP_004247165.1| PREDICTED: cyclin-P3-1 [Solanum lycopersicum... 56 2e-06 gb|EYU46584.1| hypothetical protein MIMGU_mgv1a013898mg [Erythra... 55 3e-06 ref|XP_015085984.1| PREDICTED: cyclin-P3-1 [Solanum pennellii] 55 3e-06 ref|XP_006349678.1| PREDICTED: cyclin-P3-1 isoform X2 [Solanum t... 55 3e-06 gb|PHU22670.1| Cyclin-U3-1, partial [Capsicum chinense] 55 3e-06 gb|PHT38164.1| Cyclin-U3-1, partial [Capsicum baccatum] 55 3e-06 ref|XP_012832384.1| PREDICTED: LOW QUALITY PROTEIN: cyclin-P3-1 ... 55 4e-06 >gb|EYU40931.1| hypothetical protein MIMGU_mgv1a0134081mg, partial [Erythranthe guttata] gb|EYU40932.1| hypothetical protein MIMGU_mgv1a018676mg [Erythranthe guttata] Length = 137 Score = 69.3 bits (168), Expect = 6e-12 Identities = 34/43 (79%), Positives = 38/43 (88%) Frame = +2 Query: 365 MGTLALETEIICSLDYVPLGLKDPNKDYLGKPRVLSLLSTLLE 493 MG+LALE EII SLDY+ LGLKDP KDY+GKPRVLSL+ST LE Sbjct: 1 MGSLALEKEIIGSLDYISLGLKDPIKDYIGKPRVLSLVSTFLE 43 >ref|XP_012833248.1| PREDICTED: cyclin-P3-1-like isoform X1 [Erythranthe guttata] ref|XP_012833249.1| PREDICTED: cyclin-P3-1-like isoform X2 [Erythranthe guttata] Length = 221 Score = 69.3 bits (168), Expect = 3e-11 Identities = 34/43 (79%), Positives = 38/43 (88%) Frame = +2 Query: 365 MGTLALETEIICSLDYVPLGLKDPNKDYLGKPRVLSLLSTLLE 493 MG+LALE EII SLDY+ LGLKDP KDY+GKPRVLSL+ST LE Sbjct: 1 MGSLALEKEIIGSLDYISLGLKDPIKDYIGKPRVLSLVSTFLE 43 >gb|PIN14577.1| Cyclin [Handroanthus impetiginosus] Length = 217 Score = 61.2 bits (147), Expect = 3e-08 Identities = 30/43 (69%), Positives = 34/43 (79%) Frame = +2 Query: 365 MGTLALETEIICSLDYVPLGLKDPNKDYLGKPRVLSLLSTLLE 493 M ALETEI LDY+ LGLKD +KDY+GKP+VLSLLST LE Sbjct: 1 MAPSALETEITSPLDYITLGLKDSSKDYIGKPQVLSLLSTFLE 43 >ref|XP_009804077.1| PREDICTED: cyclin-P3-1 [Nicotiana sylvestris] ref|XP_016473660.1| PREDICTED: cyclin-P3-1-like [Nicotiana tabacum] ref|XP_016473661.1| PREDICTED: cyclin-P3-1-like [Nicotiana tabacum] Length = 217 Score = 57.8 bits (138), Expect = 5e-07 Identities = 30/43 (69%), Positives = 34/43 (79%) Frame = +2 Query: 365 MGTLALETEIICSLDYVPLGLKDPNKDYLGKPRVLSLLSTLLE 493 MGTLA E+E+ICS +Y+ LGLK K GKPRVLSLLSTLLE Sbjct: 1 MGTLAPESEVICSENYLALGLKVSGKQKSGKPRVLSLLSTLLE 43 >ref|XP_016449146.1| PREDICTED: cyclin-P3-1-like [Nicotiana tabacum] Length = 217 Score = 57.0 bits (136), Expect = 9e-07 Identities = 30/43 (69%), Positives = 33/43 (76%) Frame = +2 Query: 365 MGTLALETEIICSLDYVPLGLKDPNKDYLGKPRVLSLLSTLLE 493 MGTLA E+E+ICS Y+ LGLK K GKPRVLSLLSTLLE Sbjct: 1 MGTLAPESEVICSEKYLALGLKVSGKQKSGKPRVLSLLSTLLE 43 >ref|XP_009627788.1| PREDICTED: cyclin-P3-1 [Nicotiana tomentosiformis] ref|XP_018633726.1| PREDICTED: cyclin-P3-1 [Nicotiana tomentosiformis] Length = 217 Score = 57.0 bits (136), Expect = 9e-07 Identities = 30/43 (69%), Positives = 33/43 (76%) Frame = +2 Query: 365 MGTLALETEIICSLDYVPLGLKDPNKDYLGKPRVLSLLSTLLE 493 MGTLA E+E+ICS Y+ LGLK K GKPRVLSLLSTLLE Sbjct: 1 MGTLAPESEVICSEKYLALGLKVSGKQKSGKPRVLSLLSTLLE 43 >ref|XP_015165174.1| PREDICTED: cyclin-P3-1 isoform X1 [Solanum tuberosum] Length = 223 Score = 56.6 bits (135), Expect = 1e-06 Identities = 29/47 (61%), Positives = 34/47 (72%) Frame = +2 Query: 353 TSREMGTLALETEIICSLDYVPLGLKDPNKDYLGKPRVLSLLSTLLE 493 + +MGTLA E E+ CS Y+ LGLK K+ GKPRVLSLLSTLLE Sbjct: 3 SGEDMGTLAPEPEVTCSKKYLALGLKISGKEKSGKPRVLSLLSTLLE 49 >ref|XP_004247165.1| PREDICTED: cyclin-P3-1 [Solanum lycopersicum] ref|XP_010326378.1| PREDICTED: cyclin-P3-1 [Solanum lycopersicum] ref|XP_019071285.1| PREDICTED: cyclin-P3-1 [Solanum lycopersicum] Length = 217 Score = 55.8 bits (133), Expect = 2e-06 Identities = 29/43 (67%), Positives = 32/43 (74%) Frame = +2 Query: 365 MGTLALETEIICSLDYVPLGLKDPNKDYLGKPRVLSLLSTLLE 493 MGTLA E E+ CS Y+ LGLK K+ GKPRVLSLLSTLLE Sbjct: 1 MGTLAPEPEVTCSKQYLALGLKISGKEKSGKPRVLSLLSTLLE 43 >gb|EYU46584.1| hypothetical protein MIMGU_mgv1a013898mg [Erythranthe guttata] Length = 207 Score = 55.5 bits (132), Expect = 3e-06 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +2 Query: 365 MGTLALETEIICSLDYVPLGLKDPNKDYLGKPRVLSLLSTLLE 493 MGT+ +ET+ +CS +Y LGLK KD +GKP VLSLLST LE Sbjct: 1 MGTVTIETDSLCSKEYAALGLKGSRKDNIGKPGVLSLLSTFLE 43 >ref|XP_015085984.1| PREDICTED: cyclin-P3-1 [Solanum pennellii] Length = 217 Score = 55.5 bits (132), Expect = 3e-06 Identities = 29/43 (67%), Positives = 32/43 (74%) Frame = +2 Query: 365 MGTLALETEIICSLDYVPLGLKDPNKDYLGKPRVLSLLSTLLE 493 MGTLA E E+ CS Y+ LGLK K+ GKPRVLSLLSTLLE Sbjct: 1 MGTLAPEPEVTCSKKYLALGLKISGKEKSGKPRVLSLLSTLLE 43 >ref|XP_006349678.1| PREDICTED: cyclin-P3-1 isoform X2 [Solanum tuberosum] Length = 217 Score = 55.5 bits (132), Expect = 3e-06 Identities = 29/43 (67%), Positives = 32/43 (74%) Frame = +2 Query: 365 MGTLALETEIICSLDYVPLGLKDPNKDYLGKPRVLSLLSTLLE 493 MGTLA E E+ CS Y+ LGLK K+ GKPRVLSLLSTLLE Sbjct: 1 MGTLAPEPEVTCSKKYLALGLKISGKEKSGKPRVLSLLSTLLE 43 >gb|PHU22670.1| Cyclin-U3-1, partial [Capsicum chinense] Length = 219 Score = 55.5 bits (132), Expect = 3e-06 Identities = 29/45 (64%), Positives = 33/45 (73%) Frame = +2 Query: 359 REMGTLALETEIICSLDYVPLGLKDPNKDYLGKPRVLSLLSTLLE 493 ++MGTLA E E+ICS Y LGLK K+ KPRVLSLLSTLLE Sbjct: 1 QDMGTLAPEPEVICSKHYFKLGLKVSGKEKSAKPRVLSLLSTLLE 45 >gb|PHT38164.1| Cyclin-U3-1, partial [Capsicum baccatum] Length = 219 Score = 55.5 bits (132), Expect = 3e-06 Identities = 29/45 (64%), Positives = 33/45 (73%) Frame = +2 Query: 359 REMGTLALETEIICSLDYVPLGLKDPNKDYLGKPRVLSLLSTLLE 493 ++MGTLA E E+ICS Y LGLK K+ KPRVLSLLSTLLE Sbjct: 1 QDMGTLAPEPEVICSKHYFKLGLKVSGKEKSAKPRVLSLLSTLLE 45 >ref|XP_012832384.1| PREDICTED: LOW QUALITY PROTEIN: cyclin-P3-1 [Erythranthe guttata] Length = 222 Score = 55.5 bits (132), Expect = 4e-06 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +2 Query: 365 MGTLALETEIICSLDYVPLGLKDPNKDYLGKPRVLSLLSTLLE 493 MGT+ +ET+ +CS +Y LGLK KD +GKP VLSLLST LE Sbjct: 1 MGTVTIETDSLCSKEYAALGLKGSRKDNIGKPGVLSLLSTFLE 43