BLASTX nr result
ID: Rehmannia29_contig00030628
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00030628 (409 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONM41563.1| E3 ubiquitin-protein ligase SIS3 [Zea mays] 62 2e-09 ref|XP_011071838.1| E3 ubiquitin-protein ligase SIS3 [Sesamum in... 63 6e-09 gb|EPS66491.1| hypothetical protein M569_08286, partial [Genlise... 62 7e-09 gb|KHN49013.1| E3 ubiquitin-protein ligase SIS3 [Glycine soja] 60 1e-08 ref|XP_006600649.1| PREDICTED: E3 ubiquitin-protein ligase SIS3-... 62 1e-08 ref|XP_009410513.1| PREDICTED: E3 ubiquitin-protein ligase SIS3 ... 62 2e-08 gb|ONM41556.1| E3 ubiquitin-protein ligase SIS3 [Zea mays] >gi|1... 62 2e-08 ref|XP_007155417.1| hypothetical protein PHAVU_003G199700g [Phas... 61 4e-08 ref|XP_020546982.1| E3 ubiquitin-protein ligase SIS3-like isofor... 60 4e-08 ref|XP_020546981.1| E3 ubiquitin-protein ligase SIS3-like isofor... 60 4e-08 ref|XP_011101339.2| E3 ubiquitin-protein ligase SIS3-like isofor... 60 5e-08 ref|XP_022767373.1| E3 ubiquitin-protein ligase SIS3-like isofor... 60 5e-08 ref|XP_022767364.1| E3 ubiquitin-protein ligase SIS3-like isofor... 60 5e-08 ref|XP_022767353.1| E3 ubiquitin-protein ligase SIS3-like isofor... 60 5e-08 gb|PIM98904.1| hypothetical protein CDL12_28611 [Handroanthus im... 60 6e-08 ref|XP_020099868.1| E3 ubiquitin-protein ligase SIS3 isoform X5 ... 60 7e-08 gb|PIN15517.1| hypothetical protein CDL12_11831 [Handroanthus im... 60 7e-08 gb|PIN01674.1| hypothetical protein CDL12_25816 [Handroanthus im... 60 7e-08 ref|XP_004968889.1| E3 ubiquitin-protein ligase SIS3 [Setaria it... 60 7e-08 ref|XP_002457972.1| E3 ubiquitin-protein ligase SIS3 isoform X2 ... 60 7e-08 >gb|ONM41563.1| E3 ubiquitin-protein ligase SIS3 [Zea mays] Length = 134 Score = 61.6 bits (148), Expect = 2e-09 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = +3 Query: 309 RDLGSQQRYARFCGRIVVLSILVMLLYPFLLAW 407 RDLG QQRYARFCGRI+VLS+LV+LLYPFL W Sbjct: 18 RDLGWQQRYARFCGRIIVLSVLVLLLYPFLWVW 50 >ref|XP_011071838.1| E3 ubiquitin-protein ligase SIS3 [Sesamum indicum] Length = 378 Score = 63.2 bits (152), Expect = 6e-09 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = +3 Query: 312 DLGSQQRYARFCGRIVVLSILVMLLYPFLLAW 407 DLG QQRYARFCGRIVVLSILV LLYPFLLAW Sbjct: 71 DLGWQQRYARFCGRIVVLSILVALLYPFLLAW 102 >gb|EPS66491.1| hypothetical protein M569_08286, partial [Genlisea aurea] Length = 222 Score = 62.0 bits (149), Expect = 7e-09 Identities = 26/32 (81%), Positives = 32/32 (100%) Frame = +3 Query: 312 DLGSQQRYARFCGRIVVLSILVMLLYPFLLAW 407 DLGS+QRYARFCGR+VVL+ILV+LLYPFL++W Sbjct: 71 DLGSEQRYARFCGRLVVLTILVLLLYPFLISW 102 >gb|KHN49013.1| E3 ubiquitin-protein ligase SIS3 [Glycine soja] Length = 154 Score = 60.1 bits (144), Expect = 1e-08 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +3 Query: 312 DLGSQQRYARFCGRIVVLSILVMLLYPFLLAW 407 D G QQRYARFCGR+VVLSILV+LLYPFL AW Sbjct: 48 DFGWQQRYARFCGRVVVLSILVLLLYPFLWAW 79 >ref|XP_006600649.1| PREDICTED: E3 ubiquitin-protein ligase SIS3-like isoform X2 [Glycine max] gb|KRH03306.1| hypothetical protein GLYMA_17G090200 [Glycine max] Length = 323 Score = 62.0 bits (149), Expect = 1e-08 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +3 Query: 309 RDLGSQQRYARFCGRIVVLSILVMLLYPFLLAW 407 RD G QQRYARFCGR+VVLSILV+LLYPFL AW Sbjct: 10 RDFGWQQRYARFCGRVVVLSILVLLLYPFLWAW 42 >ref|XP_009410513.1| PREDICTED: E3 ubiquitin-protein ligase SIS3 [Musa acuminata subsp. malaccensis] Length = 376 Score = 62.0 bits (149), Expect = 2e-08 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = +3 Query: 312 DLGSQQRYARFCGRIVVLSILVMLLYPFLLAW 407 DLGSQQRYARFCGR+VVLS+L++LLYPFL W Sbjct: 71 DLGSQQRYARFCGRVVVLSVLILLLYPFLWVW 102 >gb|ONM41556.1| E3 ubiquitin-protein ligase SIS3 [Zea mays] gb|ONM41558.1| E3 ubiquitin-protein ligase SIS3 [Zea mays] gb|ONM41560.1| E3 ubiquitin-protein ligase SIS3 [Zea mays] Length = 322 Score = 61.6 bits (148), Expect = 2e-08 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = +3 Query: 309 RDLGSQQRYARFCGRIVVLSILVMLLYPFLLAW 407 RDLG QQRYARFCGRI+VLS+LV+LLYPFL W Sbjct: 18 RDLGWQQRYARFCGRIIVLSVLVLLLYPFLWVW 50 >ref|XP_007155417.1| hypothetical protein PHAVU_003G199700g [Phaseolus vulgaris] gb|ESW27411.1| hypothetical protein PHAVU_003G199700g [Phaseolus vulgaris] Length = 382 Score = 60.8 bits (146), Expect = 4e-08 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +3 Query: 312 DLGSQQRYARFCGRIVVLSILVMLLYPFLLAW 407 D G QQRYARFCGR+VVLSILV+LLYPFL AW Sbjct: 71 DFGRQQRYARFCGRVVVLSILVLLLYPFLWAW 102 >ref|XP_020546982.1| E3 ubiquitin-protein ligase SIS3-like isoform X3 [Sesamum indicum] Length = 283 Score = 60.5 bits (145), Expect = 4e-08 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = +3 Query: 312 DLGSQQRYARFCGRIVVLSILVMLLYPFLLAW 407 DLG QQRYARFCGRIVVLSIL +LLYPFL AW Sbjct: 37 DLGWQQRYARFCGRIVVLSILALLLYPFLWAW 68 >ref|XP_020546981.1| E3 ubiquitin-protein ligase SIS3-like isoform X2 [Sesamum indicum] Length = 288 Score = 60.5 bits (145), Expect = 4e-08 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = +3 Query: 312 DLGSQQRYARFCGRIVVLSILVMLLYPFLLAW 407 DLG QQRYARFCGRIVVLSIL +LLYPFL AW Sbjct: 42 DLGWQQRYARFCGRIVVLSILALLLYPFLWAW 73 >ref|XP_011101339.2| E3 ubiquitin-protein ligase SIS3-like isoform X1 [Sesamum indicum] Length = 317 Score = 60.5 bits (145), Expect = 5e-08 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = +3 Query: 312 DLGSQQRYARFCGRIVVLSILVMLLYPFLLAW 407 DLG QQRYARFCGRIVVLSIL +LLYPFL AW Sbjct: 71 DLGWQQRYARFCGRIVVLSILALLLYPFLWAW 102 >ref|XP_022767373.1| E3 ubiquitin-protein ligase SIS3-like isoform X3 [Durio zibethinus] ref|XP_022767383.1| E3 ubiquitin-protein ligase SIS3-like isoform X3 [Durio zibethinus] ref|XP_022767391.1| E3 ubiquitin-protein ligase SIS3-like isoform X3 [Durio zibethinus] ref|XP_022767398.1| E3 ubiquitin-protein ligase SIS3-like isoform X3 [Durio zibethinus] ref|XP_022767406.1| E3 ubiquitin-protein ligase SIS3-like isoform X3 [Durio zibethinus] ref|XP_022767416.1| E3 ubiquitin-protein ligase SIS3-like isoform X3 [Durio zibethinus] Length = 323 Score = 60.5 bits (145), Expect = 5e-08 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = +3 Query: 312 DLGSQQRYARFCGRIVVLSILVMLLYPFLLAW 407 D G QQRYARFCGRIVVLSIL +LLYPFLLAW Sbjct: 14 DFGWQQRYARFCGRIVVLSILSLLLYPFLLAW 45 >ref|XP_022767364.1| E3 ubiquitin-protein ligase SIS3-like isoform X2 [Durio zibethinus] Length = 346 Score = 60.5 bits (145), Expect = 5e-08 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = +3 Query: 312 DLGSQQRYARFCGRIVVLSILVMLLYPFLLAW 407 D G QQRYARFCGRIVVLSIL +LLYPFLLAW Sbjct: 37 DFGWQQRYARFCGRIVVLSILSLLLYPFLLAW 68 >ref|XP_022767353.1| E3 ubiquitin-protein ligase SIS3-like isoform X1 [Durio zibethinus] Length = 380 Score = 60.5 bits (145), Expect = 5e-08 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = +3 Query: 312 DLGSQQRYARFCGRIVVLSILVMLLYPFLLAW 407 D G QQRYARFCGRIVVLSIL +LLYPFLLAW Sbjct: 71 DFGWQQRYARFCGRIVVLSILSLLLYPFLLAW 102 >gb|PIM98904.1| hypothetical protein CDL12_28611 [Handroanthus impetiginosus] Length = 392 Score = 60.5 bits (145), Expect = 6e-08 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = +3 Query: 312 DLGSQQRYARFCGRIVVLSILVMLLYPFLLAW 407 DLG QQRYARFCGRIVVLSIL +LLYPFL AW Sbjct: 88 DLGWQQRYARFCGRIVVLSILTLLLYPFLWAW 119 >ref|XP_020099868.1| E3 ubiquitin-protein ligase SIS3 isoform X5 [Ananas comosus] ref|XP_020099869.1| E3 ubiquitin-protein ligase SIS3 isoform X5 [Ananas comosus] Length = 355 Score = 60.1 bits (144), Expect = 7e-08 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +3 Query: 312 DLGSQQRYARFCGRIVVLSILVMLLYPFLLAW 407 DLG QQRYARFCGRIVVLS+LV+LLYPFL W Sbjct: 14 DLGWQQRYARFCGRIVVLSVLVLLLYPFLWVW 45 >gb|PIN15517.1| hypothetical protein CDL12_11831 [Handroanthus impetiginosus] Length = 368 Score = 60.1 bits (144), Expect = 7e-08 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = +3 Query: 312 DLGSQQRYARFCGRIVVLSILVMLLYPFLLAW 407 DLGSQQRYARFC RIVVLSILV+LLYPFL W Sbjct: 71 DLGSQQRYARFCRRIVVLSILVLLLYPFLSVW 102 >gb|PIN01674.1| hypothetical protein CDL12_25816 [Handroanthus impetiginosus] Length = 368 Score = 60.1 bits (144), Expect = 7e-08 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = +3 Query: 312 DLGSQQRYARFCGRIVVLSILVMLLYPFLLAW 407 DLGSQQRYARFC RIVVLSILV+LLYPFL W Sbjct: 71 DLGSQQRYARFCRRIVVLSILVLLLYPFLSVW 102 >ref|XP_004968889.1| E3 ubiquitin-protein ligase SIS3 [Setaria italica] Length = 374 Score = 60.1 bits (144), Expect = 7e-08 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +3 Query: 312 DLGSQQRYARFCGRIVVLSILVMLLYPFLLAW 407 DLG QQRYARFCGRIVVLS+LV+LLYPFL W Sbjct: 71 DLGWQQRYARFCGRIVVLSVLVLLLYPFLWVW 102 >ref|XP_002457972.1| E3 ubiquitin-protein ligase SIS3 isoform X2 [Sorghum bicolor] gb|EES03092.1| hypothetical protein SORBI_3003G182300 [Sorghum bicolor] Length = 374 Score = 60.1 bits (144), Expect = 7e-08 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +3 Query: 312 DLGSQQRYARFCGRIVVLSILVMLLYPFLLAW 407 DLG QQRYARFCGRIVVLS+LV+LLYPFL W Sbjct: 71 DLGWQQRYARFCGRIVVLSVLVLLLYPFLWVW 102