BLASTX nr result
ID: Rehmannia29_contig00030549
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00030549 (428 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN18889.1| hypothetical protein CDL12_08434 [Handroanthus im... 93 1e-20 ref|XP_011098046.1| uncharacterized protein LOC105176825 [Sesamu... 83 7e-17 ref|XP_012845345.1| PREDICTED: RING finger protein 44 [Erythrant... 58 3e-07 >gb|PIN18889.1| hypothetical protein CDL12_08434 [Handroanthus impetiginosus] Length = 207 Score = 92.8 bits (229), Expect = 1e-20 Identities = 47/69 (68%), Positives = 48/69 (69%), Gaps = 3/69 (4%) Frame = -2 Query: 211 MSGSSRNNRPPPENWQSGHEYWIYLPTNY---YSPSGTSLNPRGGTRDPWWLFEERSTRG 41 MSGSSRN ENWQ G +YWIYLP N Y P TSLNPRG TRDP WL EERSTR Sbjct: 1 MSGSSRNR----ENWQRGQDYWIYLPQNLADNYVPPTTSLNPRGRTRDPLWLLEERSTRV 56 Query: 40 PNYGLASFP 14 P YGLA FP Sbjct: 57 PTYGLARFP 65 >ref|XP_011098046.1| uncharacterized protein LOC105176825 [Sesamum indicum] Length = 209 Score = 83.2 bits (204), Expect = 7e-17 Identities = 41/69 (59%), Positives = 48/69 (69%), Gaps = 2/69 (2%) Frame = -2 Query: 211 MSGSSRNNRPPPENWQSGHEYWIYLPTNY--YSPSGTSLNPRGGTRDPWWLFEERSTRGP 38 MSG SR++RP ENWQ G +YWIYLPTN + P + + RG TRDP W EERS RGP Sbjct: 1 MSGGSRSSRPS-ENWQPGPDYWIYLPTNLSDFLPPRRTPSQRGRTRDPRWFLEERSIRGP 59 Query: 37 NYGLASFPS 11 N GL S+PS Sbjct: 60 NNGLVSYPS 68 >ref|XP_012845345.1| PREDICTED: RING finger protein 44 [Erythranthe guttata] gb|EYU30760.1| hypothetical protein MIMGU_mgv1a013132mg [Erythranthe guttata] Length = 230 Score = 57.8 bits (138), Expect = 3e-07 Identities = 39/76 (51%), Positives = 47/76 (61%), Gaps = 8/76 (10%) Frame = -2 Query: 211 MSGSSRNNRPPPENWQSGHEYWIYLPTNY---YSPSGTSLN-PRGGTRDPWWLFEER--S 50 MSGSSR++R N Q+G+EYW YLP N + P+ TS N PR RD W LFEER Sbjct: 1 MSGSSRSSRNRG-NMQTGNEYWTYLPNNNLPDFLPARTSPNYPRERGRDSWQLFEERVIG 59 Query: 49 TRGPNYG--LASFPSA 8 GP+Y +ASFP A Sbjct: 60 GGGPSYDALMASFPHA 75