BLASTX nr result
ID: Rehmannia29_contig00030469
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00030469 (979 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KZV23276.1| hypothetical protein F511_02177 [Dorcoceras hygro... 63 1e-07 >gb|KZV23276.1| hypothetical protein F511_02177 [Dorcoceras hygrometricum] Length = 250 Score = 62.8 bits (151), Expect = 1e-07 Identities = 32/59 (54%), Positives = 45/59 (76%) Frame = -3 Query: 866 FLQVCSSEDEVTTPLKNTKNRTVSEDIVQESGLKRSLMDEFSSTAVGKNLKTVVKIEKE 690 F +V SSEDEV+TP+K+TKN S+ I+ E+ KR+L DEFS+TA K LKT++K E++ Sbjct: 194 FKEVISSEDEVSTPVKSTKNEENSKGIMNET--KRALTDEFSATAPNKKLKTIIKTEED 250