BLASTX nr result
ID: Rehmannia29_contig00030373
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00030373 (816 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN04854.1| putative ubiquitin fusion degradation protein [Ha... 66 2e-08 gb|PKI52859.1| hypothetical protein CRG98_026690 [Punica granatum] 60 1e-06 gb|OWM80413.1| hypothetical protein CDL15_Pgr019693 [Punica gran... 60 1e-06 emb|CDO96920.1| unnamed protein product [Coffea canephora] 60 1e-06 ref|XP_016476878.1| PREDICTED: E3 ubiquitin-protein ligase UPL3-... 59 4e-06 ref|XP_009623758.1| PREDICTED: E3 ubiquitin-protein ligase UPL3-... 59 5e-06 ref|XP_020553036.1| E3 ubiquitin-protein ligase UPL3 isoform X2 ... 58 8e-06 ref|XP_011092986.1| E3 ubiquitin-protein ligase UPL3 isoform X1 ... 58 8e-06 ref|XP_015893373.1| PREDICTED: E3 ubiquitin-protein ligase UPL3 ... 58 8e-06 >gb|PIN04854.1| putative ubiquitin fusion degradation protein [Handroanthus impetiginosus] Length = 1803 Score = 65.9 bits (159), Expect = 2e-08 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -2 Query: 815 KDNEMKPVEGDTSSEDDELDISPVEIDEALVIE 717 KDNEMKPVEG+TSSEDDELDISPVE+DEALVIE Sbjct: 1055 KDNEMKPVEGETSSEDDELDISPVELDEALVIE 1087 >gb|PKI52859.1| hypothetical protein CRG98_026690 [Punica granatum] Length = 1741 Score = 60.5 bits (145), Expect = 1e-06 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = -2 Query: 815 KDNEMKPVEGDTSSEDDELDISPVEIDEALVIE 717 KD +MKPVEGD+SSED+ELDISPVEID+ALVIE Sbjct: 908 KDTQMKPVEGDSSSEDEELDISPVEIDDALVIE 940 >gb|OWM80413.1| hypothetical protein CDL15_Pgr019693 [Punica granatum] Length = 1891 Score = 60.5 bits (145), Expect = 1e-06 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = -2 Query: 815 KDNEMKPVEGDTSSEDDELDISPVEIDEALVIE 717 KD +MKPVEGD+SSED+ELDISPVEID+ALVIE Sbjct: 1058 KDTQMKPVEGDSSSEDEELDISPVEIDDALVIE 1090 >emb|CDO96920.1| unnamed protein product [Coffea canephora] Length = 1911 Score = 60.5 bits (145), Expect = 1e-06 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = -2 Query: 815 KDNEMKPVEGDTSSEDDELDISPVEIDEALVIE 717 KD +MKPV GDTSSEDDELDISPVEID+ALVIE Sbjct: 1077 KDAQMKPVTGDTSSEDDELDISPVEIDDALVIE 1109 >ref|XP_016476878.1| PREDICTED: E3 ubiquitin-protein ligase UPL3-like [Nicotiana tabacum] Length = 848 Score = 58.9 bits (141), Expect = 4e-06 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = -2 Query: 815 KDNEMKPVEGDTSSEDDELDISPVEIDEALVIE 717 KD E+KPV GD+SSEDDELDISPVE+D+ALVIE Sbjct: 25 KDTEVKPVNGDSSSEDDELDISPVELDDALVIE 57 >ref|XP_009623758.1| PREDICTED: E3 ubiquitin-protein ligase UPL3-like [Nicotiana tomentosiformis] Length = 1836 Score = 58.9 bits (141), Expect = 5e-06 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = -2 Query: 815 KDNEMKPVEGDTSSEDDELDISPVEIDEALVIE 717 KD E+KPV GD+SSEDDELDISPVE+D+ALVIE Sbjct: 1013 KDTEVKPVNGDSSSEDDELDISPVELDDALVIE 1045 >ref|XP_020553036.1| E3 ubiquitin-protein ligase UPL3 isoform X2 [Sesamum indicum] Length = 1602 Score = 58.2 bits (139), Expect = 8e-06 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -2 Query: 815 KDNEMKPVEGDTSSEDDELDISPVEIDEALVIE 717 KDNEMK VEG TSSEDDELDISP+EID+ALVI+ Sbjct: 778 KDNEMKLVEGHTSSEDDELDISPLEIDDALVID 810 >ref|XP_011092986.1| E3 ubiquitin-protein ligase UPL3 isoform X1 [Sesamum indicum] Length = 1882 Score = 58.2 bits (139), Expect = 8e-06 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -2 Query: 815 KDNEMKPVEGDTSSEDDELDISPVEIDEALVIE 717 KDNEMK VEG TSSEDDELDISP+EID+ALVI+ Sbjct: 1058 KDNEMKLVEGHTSSEDDELDISPLEIDDALVID 1090 >ref|XP_015893373.1| PREDICTED: E3 ubiquitin-protein ligase UPL3 [Ziziphus jujuba] Length = 1915 Score = 58.2 bits (139), Expect = 8e-06 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = -2 Query: 815 KDNEMKPVEGDTSSEDDELDISPVEIDEALVIE 717 KD +MKPV GDT+SED+ELDISPVEID+ALVIE Sbjct: 1077 KDAQMKPVNGDTTSEDEELDISPVEIDDALVIE 1109