BLASTX nr result
ID: Rehmannia29_contig00030265
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00030265 (561 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|OTG13150.1| putative DNAJ heat shock N-terminal domain-contai... 74 5e-12 >gb|OTG13150.1| putative DNAJ heat shock N-terminal domain-containing protein [Helianthus annuus] Length = 2590 Score = 74.3 bits (181), Expect = 5e-12 Identities = 41/71 (57%), Positives = 50/71 (70%), Gaps = 1/71 (1%) Frame = -2 Query: 212 LINHLRVFRFEALGANQSRQRPLPSSSAG-GIWFFLRPSPPQPHSLHYLPAPQMDFVSRH 36 + + +R F E LGANQSRQRP S++AG G+W FLRPSPP+P+SL YL PQMDFV RH Sbjct: 1 MFSRVRTF-VEELGANQSRQRP--SAAAGTGLWSFLRPSPPKPYSLQYL--PQMDFVFRH 55 Query: 35 AVPSSDHLPAP 3 + H P P Sbjct: 56 TTDHAHHPPPP 66