BLASTX nr result
ID: Rehmannia29_contig00030006
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00030006 (474 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011095693.1| probable BOI-related E3 ubiquitin-protein li... 92 4e-19 gb|PIN05502.1| putative E3 ubiquitin ligase [Handroanthus impeti... 91 7e-19 ref|XP_012841867.1| PREDICTED: probable BOI-related E3 ubiquitin... 91 8e-19 ref|XP_022848326.1| probable BOI-related E3 ubiquitin-protein li... 89 3e-18 gb|PIN11000.1| putative E3 ubiquitin ligase [Handroanthus impeti... 89 4e-18 ref|XP_012849156.1| PREDICTED: probable BOI-related E3 ubiquitin... 89 6e-18 gb|PON95668.1| Zinc finger, RING-type [Trema orientalis] 87 9e-18 gb|PON77176.1| E3 ubiquitin-protein ligase BOI [Parasponia ander... 87 9e-18 ref|XP_022871884.1| probable BOI-related E3 ubiquitin-protein li... 88 1e-17 ref|XP_016171601.1| probable BOI-related E3 ubiquitin-protein li... 88 1e-17 ref|XP_015932303.1| probable BOI-related E3 ubiquitin-protein li... 88 1e-17 ref|XP_004294111.1| PREDICTED: probable BOI-related E3 ubiquitin... 88 1e-17 ref|XP_020233429.1| probable BOI-related E3 ubiquitin-protein li... 87 2e-17 gb|PNT59890.1| hypothetical protein POPTR_001G439200v3 [Populus ... 86 3e-17 ref|XP_024159622.1| probable BOI-related E3 ubiquitin-protein li... 87 3e-17 ref|XP_017244664.1| PREDICTED: probable BOI-related E3 ubiquitin... 87 4e-17 ref|XP_010093060.1| probable BOI-related E3 ubiquitin-protein li... 87 5e-17 ref|XP_011015002.1| PREDICTED: probable BOI-related E3 ubiquitin... 86 5e-17 ref|XP_011004876.1| PREDICTED: probable BOI-related E3 ubiquitin... 86 5e-17 ref|XP_006370471.1| hypothetical protein POPTR_0001s43020g [Popu... 86 5e-17 >ref|XP_011095693.1| probable BOI-related E3 ubiquitin-protein ligase 2 [Sesamum indicum] Length = 349 Score = 92.0 bits (227), Expect = 4e-19 Identities = 40/41 (97%), Positives = 41/41 (100%) Frame = -1 Query: 447 ESCVLLLPCRHLCLCTVCGSTLHTCPVCNSTKTASVHVNLS 325 ESCVLLLPCRHLCLCTVCGS+LHTCPVCNSTKTASVHVNLS Sbjct: 307 ESCVLLLPCRHLCLCTVCGSSLHTCPVCNSTKTASVHVNLS 347 >gb|PIN05502.1| putative E3 ubiquitin ligase [Handroanthus impetiginosus] Length = 334 Score = 91.3 bits (225), Expect = 7e-19 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -1 Query: 447 ESCVLLLPCRHLCLCTVCGSTLHTCPVCNSTKTASVHVNLS 325 ESCVLLLPCRHLCLCTVCGS LHTCPVCNSTKTASVHVNLS Sbjct: 292 ESCVLLLPCRHLCLCTVCGSCLHTCPVCNSTKTASVHVNLS 332 >ref|XP_012841867.1| PREDICTED: probable BOI-related E3 ubiquitin-protein ligase 3 [Erythranthe guttata] Length = 343 Score = 91.3 bits (225), Expect = 8e-19 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -1 Query: 447 ESCVLLLPCRHLCLCTVCGSTLHTCPVCNSTKTASVHVNLS 325 ESCVLLLPCRHLCLCTVCGSTLHTCPVCNS KTASVHVNLS Sbjct: 302 ESCVLLLPCRHLCLCTVCGSTLHTCPVCNSIKTASVHVNLS 342 >ref|XP_022848326.1| probable BOI-related E3 ubiquitin-protein ligase 2 [Olea europaea var. sylvestris] Length = 314 Score = 89.4 bits (220), Expect = 3e-18 Identities = 37/41 (90%), Positives = 40/41 (97%) Frame = -1 Query: 447 ESCVLLLPCRHLCLCTVCGSTLHTCPVCNSTKTASVHVNLS 325 ESCVLLLPCRHLCLCTVCGS+LHTCP+CNSTK ASVH+NLS Sbjct: 273 ESCVLLLPCRHLCLCTVCGSSLHTCPICNSTKNASVHINLS 313 >gb|PIN11000.1| putative E3 ubiquitin ligase [Handroanthus impetiginosus] Length = 344 Score = 89.4 bits (220), Expect = 4e-18 Identities = 39/41 (95%), Positives = 40/41 (97%) Frame = -1 Query: 447 ESCVLLLPCRHLCLCTVCGSTLHTCPVCNSTKTASVHVNLS 325 ES VLLLPCRHLCLCT+CGSTLHTCPVCNSTKTASVHVNLS Sbjct: 303 ESSVLLLPCRHLCLCTICGSTLHTCPVCNSTKTASVHVNLS 343 >ref|XP_012849156.1| PREDICTED: probable BOI-related E3 ubiquitin-protein ligase 2 [Erythranthe guttata] Length = 350 Score = 89.0 bits (219), Expect = 6e-18 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = -1 Query: 447 ESCVLLLPCRHLCLCTVCGSTLHTCPVCNSTKTASVHVNLS 325 ESCVLLLPCRHLCLCT CGS+LHTCPVCN+TKTASVHVNLS Sbjct: 308 ESCVLLLPCRHLCLCTFCGSSLHTCPVCNTTKTASVHVNLS 348 >gb|PON95668.1| Zinc finger, RING-type [Trema orientalis] Length = 236 Score = 86.7 bits (213), Expect = 9e-18 Identities = 36/41 (87%), Positives = 39/41 (95%) Frame = -1 Query: 447 ESCVLLLPCRHLCLCTVCGSTLHTCPVCNSTKTASVHVNLS 325 ESCVLLLPCRHLCLCTVCGS+LHTCP+C STK ASVHVN+S Sbjct: 196 ESCVLLLPCRHLCLCTVCGSSLHTCPICKSTKNASVHVNMS 236 >gb|PON77176.1| E3 ubiquitin-protein ligase BOI [Parasponia andersonii] Length = 236 Score = 86.7 bits (213), Expect = 9e-18 Identities = 36/41 (87%), Positives = 39/41 (95%) Frame = -1 Query: 447 ESCVLLLPCRHLCLCTVCGSTLHTCPVCNSTKTASVHVNLS 325 ESCVLLLPCRHLCLCTVCGS+LHTCP+C STK ASVHVN+S Sbjct: 196 ESCVLLLPCRHLCLCTVCGSSLHTCPICKSTKNASVHVNMS 236 >ref|XP_022871884.1| probable BOI-related E3 ubiquitin-protein ligase 2 [Olea europaea var. sylvestris] Length = 345 Score = 88.2 bits (217), Expect = 1e-17 Identities = 37/41 (90%), Positives = 40/41 (97%) Frame = -1 Query: 447 ESCVLLLPCRHLCLCTVCGSTLHTCPVCNSTKTASVHVNLS 325 ESCVLLLPCRHLCLCT+CGS+LHTCP+CNSTKTASVHV LS Sbjct: 305 ESCVLLLPCRHLCLCTLCGSSLHTCPICNSTKTASVHVKLS 345 >ref|XP_016171601.1| probable BOI-related E3 ubiquitin-protein ligase 3 [Arachis ipaensis] Length = 365 Score = 88.2 bits (217), Expect = 1e-17 Identities = 36/42 (85%), Positives = 40/42 (95%) Frame = -1 Query: 450 GESCVLLLPCRHLCLCTVCGSTLHTCPVCNSTKTASVHVNLS 325 GESCVL+LPCRHLCLCTVCGS+LHTCP+C S KTASVHVN+S Sbjct: 324 GESCVLILPCRHLCLCTVCGSSLHTCPICKSVKTASVHVNMS 365 >ref|XP_015932303.1| probable BOI-related E3 ubiquitin-protein ligase 3 [Arachis duranensis] Length = 365 Score = 88.2 bits (217), Expect = 1e-17 Identities = 36/42 (85%), Positives = 40/42 (95%) Frame = -1 Query: 450 GESCVLLLPCRHLCLCTVCGSTLHTCPVCNSTKTASVHVNLS 325 GESCVL+LPCRHLCLCTVCGS+LHTCP+C S KTASVHVN+S Sbjct: 324 GESCVLILPCRHLCLCTVCGSSLHTCPICRSVKTASVHVNMS 365 >ref|XP_004294111.1| PREDICTED: probable BOI-related E3 ubiquitin-protein ligase 3 [Fragaria vesca subsp. vesca] Length = 339 Score = 87.8 bits (216), Expect = 1e-17 Identities = 38/41 (92%), Positives = 39/41 (95%) Frame = -1 Query: 447 ESCVLLLPCRHLCLCTVCGSTLHTCPVCNSTKTASVHVNLS 325 ESCVLLLPCRHLCLCTVCGS+LHTCPVC STK ASVHVNLS Sbjct: 299 ESCVLLLPCRHLCLCTVCGSSLHTCPVCKSTKNASVHVNLS 339 >ref|XP_020233429.1| probable BOI-related E3 ubiquitin-protein ligase 3 [Cajanus cajan] gb|KYP49142.1| hypothetical protein KK1_029175 [Cajanus cajan] Length = 310 Score = 87.0 bits (214), Expect = 2e-17 Identities = 37/41 (90%), Positives = 39/41 (95%) Frame = -1 Query: 447 ESCVLLLPCRHLCLCTVCGSTLHTCPVCNSTKTASVHVNLS 325 ESCVL+LPCRHLCLCTVCGSTLHTCPVC S KTASVHVN+S Sbjct: 270 ESCVLILPCRHLCLCTVCGSTLHTCPVCKSFKTASVHVNMS 310 >gb|PNT59890.1| hypothetical protein POPTR_001G439200v3 [Populus trichocarpa] Length = 282 Score = 86.3 bits (212), Expect = 3e-17 Identities = 36/41 (87%), Positives = 39/41 (95%) Frame = -1 Query: 447 ESCVLLLPCRHLCLCTVCGSTLHTCPVCNSTKTASVHVNLS 325 ESCVLLLPCRHLCLCTVCGS+LHTCP+C +TK ASVHVNLS Sbjct: 242 ESCVLLLPCRHLCLCTVCGSSLHTCPICRATKNASVHVNLS 282 >ref|XP_024159622.1| probable BOI-related E3 ubiquitin-protein ligase 3 [Rosa chinensis] gb|PRQ30592.1| putative transcription factor C2H2 family [Rosa chinensis] Length = 349 Score = 87.0 bits (214), Expect = 3e-17 Identities = 37/41 (90%), Positives = 39/41 (95%) Frame = -1 Query: 447 ESCVLLLPCRHLCLCTVCGSTLHTCPVCNSTKTASVHVNLS 325 ESCVLLLPCRHLCLCTVCGS+LHTCPVC STK ASVHVN+S Sbjct: 309 ESCVLLLPCRHLCLCTVCGSSLHTCPVCKSTKNASVHVNMS 349 >ref|XP_017244664.1| PREDICTED: probable BOI-related E3 ubiquitin-protein ligase 3 [Daucus carota subsp. sativus] gb|KZM98902.1| hypothetical protein DCAR_013736 [Daucus carota subsp. sativus] Length = 339 Score = 86.7 bits (213), Expect = 4e-17 Identities = 36/41 (87%), Positives = 39/41 (95%) Frame = -1 Query: 447 ESCVLLLPCRHLCLCTVCGSTLHTCPVCNSTKTASVHVNLS 325 ESCVLLLPCRHLCLCTVCGS+LHTCP+C STK ASVHVN+S Sbjct: 297 ESCVLLLPCRHLCLCTVCGSSLHTCPICKSTKNASVHVNMS 337 >ref|XP_010093060.1| probable BOI-related E3 ubiquitin-protein ligase 2 [Morus notabilis] gb|EXB53388.1| Baculoviral IAP repeat-containing protein 7-A [Morus notabilis] Length = 361 Score = 86.7 bits (213), Expect = 5e-17 Identities = 36/41 (87%), Positives = 39/41 (95%) Frame = -1 Query: 447 ESCVLLLPCRHLCLCTVCGSTLHTCPVCNSTKTASVHVNLS 325 ESCVLLLPCRHLCLCTVCGS+LHTCP+C STK ASVHVN+S Sbjct: 320 ESCVLLLPCRHLCLCTVCGSSLHTCPICKSTKNASVHVNMS 360 >ref|XP_011015002.1| PREDICTED: probable BOI-related E3 ubiquitin-protein ligase 2 [Populus euphratica] Length = 336 Score = 86.3 bits (212), Expect = 5e-17 Identities = 36/41 (87%), Positives = 39/41 (95%) Frame = -1 Query: 447 ESCVLLLPCRHLCLCTVCGSTLHTCPVCNSTKTASVHVNLS 325 ESCVLLLPCRHLCLCTVCGS+LHTCP+C +TK ASVHVNLS Sbjct: 296 ESCVLLLPCRHLCLCTVCGSSLHTCPICRATKNASVHVNLS 336 >ref|XP_011004876.1| PREDICTED: probable BOI-related E3 ubiquitin-protein ligase 3 [Populus euphratica] Length = 336 Score = 86.3 bits (212), Expect = 5e-17 Identities = 36/41 (87%), Positives = 39/41 (95%) Frame = -1 Query: 447 ESCVLLLPCRHLCLCTVCGSTLHTCPVCNSTKTASVHVNLS 325 ESCVLLLPCRHLCLCTVCGS+LHTCP+C +TK ASVHVNLS Sbjct: 296 ESCVLLLPCRHLCLCTVCGSSLHTCPICRATKNASVHVNLS 336 >ref|XP_006370471.1| hypothetical protein POPTR_0001s43020g [Populus trichocarpa] gb|PNT59894.1| hypothetical protein POPTR_001G439600v3 [Populus trichocarpa] Length = 337 Score = 86.3 bits (212), Expect = 5e-17 Identities = 36/41 (87%), Positives = 39/41 (95%) Frame = -1 Query: 447 ESCVLLLPCRHLCLCTVCGSTLHTCPVCNSTKTASVHVNLS 325 ESCVLLLPCRHLCLCTVCGS+LHTCP+C +TK ASVHVNLS Sbjct: 297 ESCVLLLPCRHLCLCTVCGSSLHTCPICRATKNASVHVNLS 337