BLASTX nr result
ID: Rehmannia29_contig00029964
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00029964 (836 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKA50536.1| ataxia telangiectasia mutated family protein [Apo... 63 9e-08 gb|PKU83370.1| ataxia telangiectasia mutated family protein [Den... 59 2e-07 gb|PKU77736.1| hypothetical protein MA16_Dca005568 [Dendrobium c... 58 3e-07 gb|PKU64402.1| hypothetical protein MA16_Dca021834 [Dendrobium c... 58 3e-07 gb|PKA50681.1| hypothetical protein AXF42_Ash021015 [Apostasia s... 58 4e-07 gb|PKA47214.1| ataxia telangiectasia mutated family protein [Apo... 59 4e-07 gb|PKA54499.1| ataxia telangiectasia mutated family protein [Apo... 58 4e-07 gb|PKA60244.1| ataxia telangiectasia mutated family protein [Apo... 58 4e-07 gb|PKU75588.1| ataxia telangiectasia mutated family protein [Den... 58 5e-07 gb|PKU71453.1| ataxia telangiectasia mutated family protein [Den... 58 5e-07 gb|PKU69530.1| ataxia telangiectasia mutated family protein [Den... 58 6e-07 gb|PKA51585.1| ataxia telangiectasia mutated family protein [Apo... 58 7e-07 ref|WP_008409321.1| hypothetical protein [Solibacillus isronensi... 57 8e-07 gb|PKU81488.1| ataxia telangiectasia mutated family protein [Den... 60 1e-06 gb|PKU73666.1| ataxia telangiectasia mutated family protein [Den... 60 1e-06 gb|PKU69639.1| ataxia telangiectasia mutated family protein [Den... 60 1e-06 ref|WP_009187176.1| hypothetical protein [Cecembia lonarensis] >... 57 1e-06 gb|PKU74878.1| ataxia telangiectasia mutated family protein [Den... 60 2e-06 gb|PKU68951.1| ataxia telangiectasia mutated family protein [Den... 59 2e-06 gb|PKU76654.1| ataxia telangiectasia mutated family protein [Den... 57 2e-06 >gb|PKA50536.1| ataxia telangiectasia mutated family protein [Apostasia shenzhenica] Length = 313 Score = 63.2 bits (152), Expect = 9e-08 Identities = 23/42 (54%), Positives = 35/42 (83%) Frame = -1 Query: 836 KGRGRKTWKETIKKDMLYLEINENMAFDRKRWRDMIHIADPT 711 +GR +KTW+ETI+ D+ YL +++N+ FDR +W+ MIH+ADPT Sbjct: 272 RGRPKKTWQETIRSDLSYLNLDKNLVFDRAQWKQMIHVADPT 313 >gb|PKU83370.1| ataxia telangiectasia mutated family protein [Dendrobium catenatum] Length = 138 Score = 59.3 bits (142), Expect = 2e-07 Identities = 26/44 (59%), Positives = 33/44 (75%), Gaps = 2/44 (4%) Frame = -1 Query: 836 KGRGR--KTWKETIKKDMLYLEINENMAFDRKRWRDMIHIADPT 711 KGRGR KTW E IK D+ L++NEN+ F+R +WR IH+ADPT Sbjct: 95 KGRGRPKKTWLENIKNDLSLLDLNENLTFNRTQWRKRIHVADPT 138 >gb|PKU77736.1| hypothetical protein MA16_Dca005568 [Dendrobium catenatum] Length = 106 Score = 58.2 bits (139), Expect = 3e-07 Identities = 25/44 (56%), Positives = 33/44 (75%), Gaps = 2/44 (4%) Frame = -1 Query: 836 KGRGR--KTWKETIKKDMLYLEINENMAFDRKRWRDMIHIADPT 711 KGRGR KTW E I+ D+ L++NEN+ F+R +WR IH+ADPT Sbjct: 63 KGRGRPKKTWLENIRNDLSLLDLNENLTFNRTQWRKRIHVADPT 106 >gb|PKU64402.1| hypothetical protein MA16_Dca021834 [Dendrobium catenatum] Length = 106 Score = 58.2 bits (139), Expect = 3e-07 Identities = 25/44 (56%), Positives = 33/44 (75%), Gaps = 2/44 (4%) Frame = -1 Query: 836 KGRGR--KTWKETIKKDMLYLEINENMAFDRKRWRDMIHIADPT 711 KGRGR KTW E I+ D+ L++NEN+ F+R +WR IH+ADPT Sbjct: 63 KGRGRPKKTWLENIRNDLSLLDLNENLTFNRTQWRKRIHVADPT 106 >gb|PKA50681.1| hypothetical protein AXF42_Ash021015 [Apostasia shenzhenica] Length = 103 Score = 57.8 bits (138), Expect = 4e-07 Identities = 22/45 (48%), Positives = 34/45 (75%) Frame = -1 Query: 836 KGRGRKTWKETIKKDMLYLEINENMAFDRKRWRDMIHIADPT*WD 702 +GR +KTW+ETI+ D+ YL +++N+ DR + + IH+ADPT WD Sbjct: 59 RGRPKKTWQETIRSDLSYLNLDKNLVTDRAQGKQRIHVADPTQWD 103 >gb|PKA47214.1| ataxia telangiectasia mutated family protein [Apostasia shenzhenica] Length = 132 Score = 58.5 bits (140), Expect = 4e-07 Identities = 21/42 (50%), Positives = 34/42 (80%) Frame = -1 Query: 836 KGRGRKTWKETIKKDMLYLEINENMAFDRKRWRDMIHIADPT 711 +GR +KTW+ETI+ D+ YL++++N+ DR +W+ IH+ADPT Sbjct: 91 RGRPKKTWQETIRSDLSYLDLDKNLVTDRAQWKQRIHVADPT 132 >gb|PKA54499.1| ataxia telangiectasia mutated family protein [Apostasia shenzhenica] Length = 108 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/42 (50%), Positives = 33/42 (78%) Frame = -1 Query: 836 KGRGRKTWKETIKKDMLYLEINENMAFDRKRWRDMIHIADPT 711 +GR +KTW+ETI+ D+ YL +++N+ DR +W+ IH+ADPT Sbjct: 67 RGRPKKTWQETIRSDLSYLNLDKNLVTDRAQWKQRIHVADPT 108 >gb|PKA60244.1| ataxia telangiectasia mutated family protein [Apostasia shenzhenica] Length = 110 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/42 (50%), Positives = 33/42 (78%) Frame = -1 Query: 836 KGRGRKTWKETIKKDMLYLEINENMAFDRKRWRDMIHIADPT 711 +GR +KTW+ETI+ D+ YL +++N+ DR +W+ IH+ADPT Sbjct: 69 RGRPKKTWQETIRSDLSYLNLDKNLVTDRAQWKQRIHVADPT 110 >gb|PKU75588.1| ataxia telangiectasia mutated family protein [Dendrobium catenatum] gb|PKU79920.1| ataxia telangiectasia mutated family protein [Dendrobium catenatum] Length = 132 Score = 58.2 bits (139), Expect = 5e-07 Identities = 25/44 (56%), Positives = 33/44 (75%), Gaps = 2/44 (4%) Frame = -1 Query: 836 KGRGR--KTWKETIKKDMLYLEINENMAFDRKRWRDMIHIADPT 711 KGRGR KTW E I+ D+ L++NEN+ F+R +WR IH+ADPT Sbjct: 89 KGRGRPKKTWLENIRNDLSLLDLNENLTFNRTQWRKRIHVADPT 132 >gb|PKU71453.1| ataxia telangiectasia mutated family protein [Dendrobium catenatum] Length = 132 Score = 58.2 bits (139), Expect = 5e-07 Identities = 25/44 (56%), Positives = 33/44 (75%), Gaps = 2/44 (4%) Frame = -1 Query: 836 KGRGR--KTWKETIKKDMLYLEINENMAFDRKRWRDMIHIADPT 711 KGRGR KTW E I+ D+ L++NEN+ F+R +WR IH+ADPT Sbjct: 89 KGRGRPKKTWLENIRNDLSLLDLNENLTFNRTQWRKRIHVADPT 132 >gb|PKU69530.1| ataxia telangiectasia mutated family protein [Dendrobium catenatum] Length = 138 Score = 58.2 bits (139), Expect = 6e-07 Identities = 25/44 (56%), Positives = 33/44 (75%), Gaps = 2/44 (4%) Frame = -1 Query: 836 KGRGR--KTWKETIKKDMLYLEINENMAFDRKRWRDMIHIADPT 711 KGRGR KTW E I+ D+ L++NEN+ F+R +WR IH+ADPT Sbjct: 95 KGRGRPKKTWLENIRNDLSLLDLNENLTFNRTQWRKRIHVADPT 138 >gb|PKA51585.1| ataxia telangiectasia mutated family protein [Apostasia shenzhenica] Length = 132 Score = 57.8 bits (138), Expect = 7e-07 Identities = 21/42 (50%), Positives = 33/42 (78%) Frame = -1 Query: 836 KGRGRKTWKETIKKDMLYLEINENMAFDRKRWRDMIHIADPT 711 +GR +KTW+ETI+ D+ YL +++N+ DR +W+ IH+ADPT Sbjct: 91 RGRPKKTWQETIRNDLSYLNLDKNLVTDRAQWKQRIHVADPT 132 >ref|WP_008409321.1| hypothetical protein [Solibacillus isronensis] gb|EKB43273.1| hypothetical protein B857_03969 [Solibacillus isronensis B3W22] Length = 109 Score = 57.0 bits (136), Expect = 8e-07 Identities = 24/42 (57%), Positives = 33/42 (78%) Frame = -1 Query: 836 KGRGRKTWKETIKKDMLYLEINENMAFDRKRWRDMIHIADPT 711 +GR RKT +ET++KD+ YL++ E+M DR +WR IHIADPT Sbjct: 67 RGRPRKTLEETLRKDLEYLDLTEDMTQDRAQWRSKIHIADPT 108 >gb|PKU81488.1| ataxia telangiectasia mutated family protein [Dendrobium catenatum] Length = 258 Score = 59.7 bits (143), Expect = 1e-06 Identities = 26/44 (59%), Positives = 34/44 (77%), Gaps = 2/44 (4%) Frame = -1 Query: 836 KGRGR--KTWKETIKKDMLYLEINENMAFDRKRWRDMIHIADPT 711 KGRGR KTW E I+ D+ L++NEN+AF+R +WR IH+ADPT Sbjct: 215 KGRGRPKKTWLENIRNDLSLLDLNENLAFNRTQWRKRIHVADPT 258 >gb|PKU73666.1| ataxia telangiectasia mutated family protein [Dendrobium catenatum] gb|PKU86798.1| ataxia telangiectasia mutated family protein [Dendrobium catenatum] gb|PKU87987.1| ataxia telangiectasia mutated family protein [Dendrobium catenatum] Length = 258 Score = 59.7 bits (143), Expect = 1e-06 Identities = 26/44 (59%), Positives = 34/44 (77%), Gaps = 2/44 (4%) Frame = -1 Query: 836 KGRGR--KTWKETIKKDMLYLEINENMAFDRKRWRDMIHIADPT 711 KGRGR KTW E I+ D+ L++NEN+AF+R +WR IH+ADPT Sbjct: 215 KGRGRPKKTWLENIRNDLSLLDLNENLAFNRTQWRKRIHVADPT 258 >gb|PKU69639.1| ataxia telangiectasia mutated family protein [Dendrobium catenatum] Length = 258 Score = 59.7 bits (143), Expect = 1e-06 Identities = 26/44 (59%), Positives = 34/44 (77%), Gaps = 2/44 (4%) Frame = -1 Query: 836 KGRGR--KTWKETIKKDMLYLEINENMAFDRKRWRDMIHIADPT 711 KGRGR KTW E I+ D+ L++NEN+AF+R +WR IH+ADPT Sbjct: 215 KGRGRPKKTWLENIRNDLSLLDLNENLAFNRTQWRKRIHVADPT 258 >ref|WP_009187176.1| hypothetical protein [Cecembia lonarensis] gb|EKB47241.1| hypothetical protein B879_04163 [Cecembia lonarensis LW9] Length = 133 Score = 57.0 bits (136), Expect = 1e-06 Identities = 24/42 (57%), Positives = 33/42 (78%) Frame = -1 Query: 836 KGRGRKTWKETIKKDMLYLEINENMAFDRKRWRDMIHIADPT 711 +GR RKT +ET++KD+ YL++ E+M DR +WR IHIADPT Sbjct: 91 RGRPRKTLEETLRKDLEYLDLTEDMTQDRAQWRSRIHIADPT 132 >gb|PKU74878.1| ataxia telangiectasia mutated family protein [Dendrobium catenatum] Length = 361 Score = 59.7 bits (143), Expect = 2e-06 Identities = 26/44 (59%), Positives = 34/44 (77%), Gaps = 2/44 (4%) Frame = -1 Query: 836 KGRGR--KTWKETIKKDMLYLEINENMAFDRKRWRDMIHIADPT 711 KGRGR KTW E I+ D+ L++NEN+AF+R +WR IH+ADPT Sbjct: 318 KGRGRPKKTWLENIRNDLSLLDLNENLAFNRTQWRKRIHVADPT 361 >gb|PKU68951.1| ataxia telangiectasia mutated family protein [Dendrobium catenatum] Length = 222 Score = 58.5 bits (140), Expect = 2e-06 Identities = 25/44 (56%), Positives = 33/44 (75%), Gaps = 2/44 (4%) Frame = -1 Query: 836 KGRGR--KTWKETIKKDMLYLEINENMAFDRKRWRDMIHIADPT 711 KGRGR K W E I+ D+ L++NEN+ F+R +WR MIH+ADPT Sbjct: 179 KGRGRPKKAWLENIRNDLSLLDLNENLTFNRTQWRKMIHVADPT 222 >gb|PKU76654.1| ataxia telangiectasia mutated family protein [Dendrobium catenatum] Length = 132 Score = 56.6 bits (135), Expect = 2e-06 Identities = 24/44 (54%), Positives = 33/44 (75%), Gaps = 2/44 (4%) Frame = -1 Query: 836 KGRGR--KTWKETIKKDMLYLEINENMAFDRKRWRDMIHIADPT 711 KGRGR KTW E I+ D+ L++N+N+ F+R +WR IH+ADPT Sbjct: 89 KGRGRPKKTWLENIRNDLSLLDLNKNLTFNRTQWRKRIHVADPT 132