BLASTX nr result
ID: Rehmannia29_contig00029941
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00029941 (407 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_016542738.1| PREDICTED: uncharacterized protein LOC107843... 53 4e-06 >ref|XP_016542738.1| PREDICTED: uncharacterized protein LOC107843085 isoform X1 [Capsicum annuum] Length = 114 Score = 52.8 bits (125), Expect = 4e-06 Identities = 28/55 (50%), Positives = 39/55 (70%), Gaps = 1/55 (1%) Frame = +2 Query: 5 IELGRKVGRSEVWLDTHKKKDGTYVNEAAKNISVSYNCIYNI-YSICLVTLNIMS 166 +E G K GR+E++LDTHKK+DG++VNE AK I V N + +I Y +V LN+ S Sbjct: 28 VETGHKPGRAELYLDTHKKEDGSHVNEVAKEICV--NTLLSIFYRFNIVLLNLKS 80