BLASTX nr result
ID: Rehmannia29_contig00029660
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00029660 (451 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007134745.1| hypothetical protein PHAVU_010G072400g [Phas... 67 2e-10 ref|XP_007134746.1| hypothetical protein PHAVU_010G072400g [Phas... 67 2e-10 ref|XP_020272299.1| vesicle-associated protein 1-1-like [Asparag... 63 4e-10 ref|XP_022030127.1| vesicle-associated protein 1-2-like [Heliant... 65 1e-09 dbj|GAU30805.1| hypothetical protein TSUD_267250 [Trifolium subt... 64 2e-09 ref|XP_010053934.1| PREDICTED: vesicle-associated protein 1-2 [E... 64 2e-09 gb|ACJ85490.1| unknown, partial [Medicago truncatula] 64 2e-09 ref|XP_003605240.1| VAMP-associated protein [Medicago truncatula... 64 2e-09 gb|PHT60710.1| Vesicle-associated protein 1-4 [Capsicum baccatum] 64 3e-09 gb|KCW78311.1| hypothetical protein EUGRSUZ_D02491 [Eucalyptus g... 64 3e-09 ref|XP_018820299.1| PREDICTED: vesicle-associated protein 1-1-li... 62 5e-09 gb|KRH65383.1| hypothetical protein GLYMA_03G032100 [Glycine max] 63 5e-09 gb|ACU13560.1| unknown [Glycine max] 63 6e-09 gb|ONK59044.1| uncharacterized protein A4U43_C08F2390 [Asparagus... 62 6e-09 gb|KOM57667.1| hypothetical protein LR48_Vigan11g070000 [Vigna a... 62 6e-09 ref|XP_024029821.1| vesicle-associated protein 1-3 [Morus notabi... 63 6e-09 ref|XP_004506475.1| PREDICTED: vesicle-associated protein 1-1-li... 63 6e-09 ref|NP_001235834.2| uncharacterized protein LOC100305725 [Glycin... 63 7e-09 ref|XP_003517022.1| PREDICTED: vesicle-associated protein 1-2-li... 63 7e-09 ref|XP_022733847.1| vesicle-associated protein 1-2-like [Durio z... 63 7e-09 >ref|XP_007134745.1| hypothetical protein PHAVU_010G072400g [Phaseolus vulgaris] gb|ESW06739.1| hypothetical protein PHAVU_010G072400g [Phaseolus vulgaris] Length = 231 Score = 67.0 bits (162), Expect = 2e-10 Identities = 29/47 (61%), Positives = 41/47 (87%) Frame = -2 Query: 450 PQSTCDITVRSRAQSEILLNMECKDKFLIKSIIASPLATSEDITPDM 310 P+STCDITV ++Q E L+M+CKDKFL++S++ASP AT++DITP+M Sbjct: 61 PRSTCDITVTMQSQKEAPLDMQCKDKFLLQSVVASPGATTKDITPEM 107 >ref|XP_007134746.1| hypothetical protein PHAVU_010G072400g [Phaseolus vulgaris] gb|ESW06740.1| hypothetical protein PHAVU_010G072400g [Phaseolus vulgaris] Length = 242 Score = 67.0 bits (162), Expect = 2e-10 Identities = 29/47 (61%), Positives = 41/47 (87%) Frame = -2 Query: 450 PQSTCDITVRSRAQSEILLNMECKDKFLIKSIIASPLATSEDITPDM 310 P+STCDITV ++Q E L+M+CKDKFL++S++ASP AT++DITP+M Sbjct: 61 PRSTCDITVTMQSQKEAPLDMQCKDKFLLQSVVASPGATTKDITPEM 107 >ref|XP_020272299.1| vesicle-associated protein 1-1-like [Asparagus officinalis] Length = 105 Score = 63.2 bits (152), Expect = 4e-10 Identities = 30/53 (56%), Positives = 41/53 (77%) Frame = -2 Query: 450 PQSTCDITVRSRAQSEILLNMECKDKFLIKSIIASPLATSEDITPDMVVA*LI 292 P STCD+TV +AQ E L+M+CKDKFL++S++A TS+DITP+MV + LI Sbjct: 50 PGSTCDVTVTMQAQKESPLDMQCKDKFLLQSVVAEHGVTSKDITPEMVHSLLI 102 >ref|XP_022030127.1| vesicle-associated protein 1-2-like [Helianthus annuus] gb|OTG33049.1| putative major sperm protein (MSP) domain, Vesicle-associated membrane-protein-associated protein [Helianthus annuus] Length = 236 Score = 64.7 bits (156), Expect = 1e-09 Identities = 28/47 (59%), Positives = 39/47 (82%) Frame = -2 Query: 450 PQSTCDITVRSRAQSEILLNMECKDKFLIKSIIASPLATSEDITPDM 310 P STCD+TV +AQ E L+M+CKDKFL++S +ASP AT++DITP++ Sbjct: 61 PHSTCDVTVTMQAQKEAPLDMQCKDKFLLQSAVASPGATTKDITPEL 107 >dbj|GAU30805.1| hypothetical protein TSUD_267250 [Trifolium subterraneum] Length = 205 Score = 63.9 bits (154), Expect = 2e-09 Identities = 28/47 (59%), Positives = 39/47 (82%) Frame = -2 Query: 450 PQSTCDITVRSRAQSEILLNMECKDKFLIKSIIASPLATSEDITPDM 310 P+STCDITV + Q E +M+CKDKFL++S++ASP AT++DITP+M Sbjct: 61 PRSTCDITVTMQGQKEAPPDMQCKDKFLLQSVVASPGATAKDITPEM 107 >ref|XP_010053934.1| PREDICTED: vesicle-associated protein 1-2 [Eucalyptus grandis] Length = 238 Score = 64.3 bits (155), Expect = 2e-09 Identities = 29/47 (61%), Positives = 38/47 (80%) Frame = -2 Query: 450 PQSTCDITVRSRAQSEILLNMECKDKFLIKSIIASPLATSEDITPDM 310 P+STCD+ V +AQ E L+M CKDKFL++S+IASP AT +DITP+M Sbjct: 61 PRSTCDVIVTMQAQKEAPLDMNCKDKFLLQSVIASPGATPKDITPEM 107 >gb|ACJ85490.1| unknown, partial [Medicago truncatula] Length = 227 Score = 63.9 bits (154), Expect = 2e-09 Identities = 28/47 (59%), Positives = 39/47 (82%) Frame = -2 Query: 450 PQSTCDITVRSRAQSEILLNMECKDKFLIKSIIASPLATSEDITPDM 310 P+STCDITV + Q E +M+CKDKFL++S++ASP AT++DITP+M Sbjct: 61 PRSTCDITVTMQGQKEAPPDMQCKDKFLLQSVVASPGATAKDITPEM 107 >ref|XP_003605240.1| VAMP-associated protein [Medicago truncatula] gb|ABW70158.1| vesicle-associated protein [Medicago truncatula] gb|AES87437.1| VAMP-associated protein [Medicago truncatula] gb|AFK39573.1| unknown [Medicago truncatula] Length = 240 Score = 63.9 bits (154), Expect = 2e-09 Identities = 28/47 (59%), Positives = 39/47 (82%) Frame = -2 Query: 450 PQSTCDITVRSRAQSEILLNMECKDKFLIKSIIASPLATSEDITPDM 310 P+STCDITV + Q E +M+CKDKFL++S++ASP AT++DITP+M Sbjct: 61 PRSTCDITVTMQGQKEAPPDMQCKDKFLLQSVVASPGATAKDITPEM 107 >gb|PHT60710.1| Vesicle-associated protein 1-4 [Capsicum baccatum] Length = 233 Score = 63.5 bits (153), Expect = 3e-09 Identities = 27/47 (57%), Positives = 38/47 (80%) Frame = -2 Query: 450 PQSTCDITVRSRAQSEILLNMECKDKFLIKSIIASPLATSEDITPDM 310 P+STCD+ V +AQ E +M+CKDKFL++S++ASPL T +DITP+M Sbjct: 61 PRSTCDVIVTMQAQKEAPPDMQCKDKFLLQSVVASPLTTPKDITPEM 107 >gb|KCW78311.1| hypothetical protein EUGRSUZ_D02491 [Eucalyptus grandis] Length = 317 Score = 64.3 bits (155), Expect = 3e-09 Identities = 29/47 (61%), Positives = 38/47 (80%) Frame = -2 Query: 450 PQSTCDITVRSRAQSEILLNMECKDKFLIKSIIASPLATSEDITPDM 310 P+STCD+ V +AQ E L+M CKDKFL++S+IASP AT +DITP+M Sbjct: 140 PRSTCDVIVTMQAQKEAPLDMNCKDKFLLQSVIASPGATPKDITPEM 186 >ref|XP_018820299.1| PREDICTED: vesicle-associated protein 1-1-like isoform X1 [Juglans regia] Length = 195 Score = 62.4 bits (150), Expect = 5e-09 Identities = 27/47 (57%), Positives = 39/47 (82%) Frame = -2 Query: 450 PQSTCDITVRSRAQSEILLNMECKDKFLIKSIIASPLATSEDITPDM 310 P+STCD+TV +AQ E +M+CKDKFL++S++ASP AT ++ITP+M Sbjct: 61 PRSTCDVTVTMQAQKEAPPDMQCKDKFLLQSVVASPGATVKEITPEM 107 >gb|KRH65383.1| hypothetical protein GLYMA_03G032100 [Glycine max] Length = 222 Score = 62.8 bits (151), Expect = 5e-09 Identities = 27/47 (57%), Positives = 39/47 (82%) Frame = -2 Query: 450 PQSTCDITVRSRAQSEILLNMECKDKFLIKSIIASPLATSEDITPDM 310 P+STCD+ V +AQ E +M+CKDKFL++S++ASP AT++DITP+M Sbjct: 61 PRSTCDVIVTMQAQKEAPPDMQCKDKFLLQSVVASPGATTKDITPEM 107 >gb|ACU13560.1| unknown [Glycine max] Length = 229 Score = 62.8 bits (151), Expect = 6e-09 Identities = 27/47 (57%), Positives = 39/47 (82%) Frame = -2 Query: 450 PQSTCDITVRSRAQSEILLNMECKDKFLIKSIIASPLATSEDITPDM 310 P+STCD+ V +AQ E +M+CKDKFL++S++ASP AT++DITP+M Sbjct: 61 PRSTCDVIVTMQAQKEAPPDMQCKDKFLLQSVVASPGATTKDITPEM 107 >gb|ONK59044.1| uncharacterized protein A4U43_C08F2390 [Asparagus officinalis] Length = 184 Score = 62.0 bits (149), Expect = 6e-09 Identities = 28/48 (58%), Positives = 38/48 (79%) Frame = -2 Query: 450 PQSTCDITVRSRAQSEILLNMECKDKFLIKSIIASPLATSEDITPDMV 307 P STCD+TV +AQ E L+M+CKDKFL++S++A AT +DITP+MV Sbjct: 61 PGSTCDVTVTMQAQKEAPLDMQCKDKFLLQSVVAEHGATLKDITPEMV 108 >gb|KOM57667.1| hypothetical protein LR48_Vigan11g070000 [Vigna angularis] Length = 210 Score = 62.4 bits (150), Expect = 6e-09 Identities = 27/47 (57%), Positives = 38/47 (80%) Frame = -2 Query: 450 PQSTCDITVRSRAQSEILLNMECKDKFLIKSIIASPLATSEDITPDM 310 P+STCD+ V +AQ E M+CKDKFL++S++ASP AT++DITP+M Sbjct: 61 PRSTCDVIVTMQAQKEAPPEMQCKDKFLLQSVVASPGATTKDITPEM 107 >ref|XP_024029821.1| vesicle-associated protein 1-3 [Morus notabilis] Length = 238 Score = 62.8 bits (151), Expect = 6e-09 Identities = 28/47 (59%), Positives = 39/47 (82%) Frame = -2 Query: 450 PQSTCDITVRSRAQSEILLNMECKDKFLIKSIIASPLATSEDITPDM 310 P+STC++TV +AQ E LL+M+CKDKFL++S+ A ATS+DITP+M Sbjct: 61 PRSTCNVTVTMQAQKETLLDMQCKDKFLLQSVSAPDGATSKDITPEM 107 >ref|XP_004506475.1| PREDICTED: vesicle-associated protein 1-1-like [Cicer arietinum] Length = 240 Score = 62.8 bits (151), Expect = 6e-09 Identities = 28/47 (59%), Positives = 39/47 (82%) Frame = -2 Query: 450 PQSTCDITVRSRAQSEILLNMECKDKFLIKSIIASPLATSEDITPDM 310 P+STCDI V +AQ E +M+CKDKFL++S++ASP AT++DITP+M Sbjct: 61 PRSTCDIIVTMQAQKESPPDMQCKDKFLLQSVVASPGATTKDITPEM 107 >ref|NP_001235834.2| uncharacterized protein LOC100305725 [Glycine max] gb|KHN38822.1| Vesicle-associated protein 1-2 [Glycine soja] gb|KRH65384.1| hypothetical protein GLYMA_03G032100 [Glycine max] Length = 241 Score = 62.8 bits (151), Expect = 7e-09 Identities = 27/47 (57%), Positives = 39/47 (82%) Frame = -2 Query: 450 PQSTCDITVRSRAQSEILLNMECKDKFLIKSIIASPLATSEDITPDM 310 P+STCD+ V +AQ E +M+CKDKFL++S++ASP AT++DITP+M Sbjct: 61 PRSTCDVIVTMQAQKEAPPDMQCKDKFLLQSVVASPGATTKDITPEM 107 >ref|XP_003517022.1| PREDICTED: vesicle-associated protein 1-2-like [Glycine max] gb|KHN26304.1| Vesicle-associated protein 1-2 [Glycine soja] gb|KRH76164.1| hypothetical protein GLYMA_01G136000 [Glycine max] Length = 241 Score = 62.8 bits (151), Expect = 7e-09 Identities = 27/47 (57%), Positives = 39/47 (82%) Frame = -2 Query: 450 PQSTCDITVRSRAQSEILLNMECKDKFLIKSIIASPLATSEDITPDM 310 P+STCD+ V +AQ E +M+CKDKFL++S++ASP AT++DITP+M Sbjct: 61 PRSTCDVIVTMQAQKEAPPDMQCKDKFLLQSVVASPGATTKDITPEM 107 >ref|XP_022733847.1| vesicle-associated protein 1-2-like [Durio zibethinus] Length = 242 Score = 62.8 bits (151), Expect = 7e-09 Identities = 27/47 (57%), Positives = 39/47 (82%) Frame = -2 Query: 450 PQSTCDITVRSRAQSEILLNMECKDKFLIKSIIASPLATSEDITPDM 310 P+STC++ V +AQ E L +M+CKDKFL++S++ASP AT +DITP+M Sbjct: 62 PRSTCNVIVTMQAQKEALPDMQCKDKFLLQSVVASPGATPKDITPEM 108