BLASTX nr result
ID: Rehmannia29_contig00029163
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00029163 (1167 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022154803.1| uncharacterized protein LOC111021969 [Momord... 44 7e-06 ref|XP_024006792.1| uncharacterized protein LOC112083362 [Eutrem... 48 9e-06 >ref|XP_022154803.1| uncharacterized protein LOC111021969 [Momordica charantia] Length = 844 Score = 43.9 bits (102), Expect(2) = 7e-06 Identities = 26/73 (35%), Positives = 38/73 (52%) Frame = -2 Query: 377 AR*REDRFRYNEYIIFHSAESFNNHIIWVRRFPICLVLEIVRKIIE*WFYKWRAAGEDRE 198 AR + RYN+ + + AES N ++ R PI + E R +++ WFY R AG R Sbjct: 618 ARTYQPGMRYNQ-MTSNLAESMNAVLVHARDLPITALFENCRSLLQQWFYDRRTAGSSRG 676 Query: 197 HELTKVVANALRE 159 LT+ N L+E Sbjct: 677 TFLTEYAENILKE 689 Score = 35.8 bits (81), Expect(2) = 7e-06 Identities = 15/29 (51%), Positives = 20/29 (68%) Frame = -3 Query: 88 TKTFDNLNAKTCTCRRFEHLLIPYSHGAA 2 TK N+N+KTCTC++F + IP SH A Sbjct: 714 TKVRVNINSKTCTCKQFYYYEIPCSHAIA 742 >ref|XP_024006792.1| uncharacterized protein LOC112083362 [Eutrema salsugineum] Length = 593 Score = 48.1 bits (113), Expect(2) = 9e-06 Identities = 29/67 (43%), Positives = 37/67 (55%) Frame = -2 Query: 353 RYNEYIIFHSAESFNNHIIWVRRFPICLVLEIVRKIIE*WFYKWRAAGEDREHELTKVVA 174 RYN + + AES N + VR +PI +LE +R ++ WF K R A D E ELT V Sbjct: 404 RYN-FTTSNIAESLNKVLSKVRSYPIVTLLEEIRSLLTRWFAKRRRAANDMETELTTGVE 462 Query: 173 NALREAV 153 LRE V Sbjct: 463 KLLRERV 469 Score = 31.2 bits (69), Expect(2) = 9e-06 Identities = 14/24 (58%), Positives = 15/24 (62%) Frame = -3 Query: 73 NLNAKTCTCRRFEHLLIPYSHGAA 2 NL KTCTCRRF+ IP H A Sbjct: 497 NLERKTCTCRRFDIDKIPCVHALA 520