BLASTX nr result
ID: Rehmannia29_contig00028787
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00028787 (515 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN13966.1| hypothetical protein CDL12_13408 [Handroanthus im... 54 2e-06 >gb|PIN13966.1| hypothetical protein CDL12_13408 [Handroanthus impetiginosus] Length = 84 Score = 53.5 bits (127), Expect = 2e-06 Identities = 24/35 (68%), Positives = 28/35 (80%) Frame = -3 Query: 135 FLAARLLNPEIKHSLWPNNHSTVTFKHNHNGKTRY 31 F AA LLNP+I+HSL NNHS V KHN+NGKTR+ Sbjct: 49 FSAANLLNPKIEHSLGSNNHSKVISKHNYNGKTRF 83