BLASTX nr result
ID: Rehmannia29_contig00028767
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00028767 (425 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN23459.1| hypothetical protein CDL12_03835 [Handroanthus im... 63 5e-09 gb|PIN23458.1| hypothetical protein CDL12_03834 [Handroanthus im... 53 1e-06 gb|PRQ29394.1| hypothetical protein RchiOBHm_Chr5g0013401 [Rosa ... 52 2e-06 gb|ONI10935.1| hypothetical protein PRUPE_4G077000 [Prunus persica] 52 2e-06 gb|PIN23598.1| hypothetical protein CDL12_03670 [Handroanthus im... 51 5e-06 gb|KDO78119.1| hypothetical protein CISIN_1g048001mg [Citrus sin... 50 7e-06 ref|XP_011085262.1| transcription factor bHLH144 [Sesamum indicu... 54 8e-06 ref|XP_011096522.1| transcription factor bHLH144 [Sesamum indicu... 54 8e-06 >gb|PIN23459.1| hypothetical protein CDL12_03835 [Handroanthus impetiginosus] Length = 234 Score = 62.8 bits (151), Expect = 5e-09 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = +1 Query: 325 MNSNQPYFPGQPMQPLADQYGYYTQNAPMASVF 423 M++NQPYFPGQPMQPLADQ+GY QNAP ASVF Sbjct: 1 MHNNQPYFPGQPMQPLADQFGYCMQNAPTASVF 33 >gb|PIN23458.1| hypothetical protein CDL12_03834 [Handroanthus impetiginosus] Length = 70 Score = 53.1 bits (126), Expect = 1e-06 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = +1 Query: 4 GSIAFYQLMQVCQAEYFRQLLKPVT 78 G+IAFYQLMQVCQAEYFRQLLKPVT Sbjct: 46 GTIAFYQLMQVCQAEYFRQLLKPVT 70 >gb|PRQ29394.1| hypothetical protein RchiOBHm_Chr5g0013401 [Rosa chinensis] Length = 48 Score = 52.0 bits (123), Expect = 2e-06 Identities = 23/26 (88%), Positives = 25/26 (96%) Frame = +1 Query: 1 IGSIAFYQLMQVCQAEYFRQLLKPVT 78 +G IA+YQLMQVCQAEYFRQLLKPVT Sbjct: 23 VGIIAYYQLMQVCQAEYFRQLLKPVT 48 >gb|ONI10935.1| hypothetical protein PRUPE_4G077000 [Prunus persica] Length = 48 Score = 52.0 bits (123), Expect = 2e-06 Identities = 23/26 (88%), Positives = 25/26 (96%) Frame = +1 Query: 1 IGSIAFYQLMQVCQAEYFRQLLKPVT 78 +G IA+YQLMQVCQAEYFRQLLKPVT Sbjct: 23 VGVIAYYQLMQVCQAEYFRQLLKPVT 48 >gb|PIN23598.1| hypothetical protein CDL12_03670 [Handroanthus impetiginosus] Length = 43 Score = 50.8 bits (120), Expect = 5e-06 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +1 Query: 1 IGSIAFYQLMQVCQAEYFRQLLKPVT 78 +GSIAFYQLMQV QAEYFRQLLKPVT Sbjct: 18 VGSIAFYQLMQVRQAEYFRQLLKPVT 43 >gb|KDO78119.1| hypothetical protein CISIN_1g048001mg [Citrus sinensis] Length = 48 Score = 50.4 bits (119), Expect = 7e-06 Identities = 22/26 (84%), Positives = 25/26 (96%) Frame = +1 Query: 1 IGSIAFYQLMQVCQAEYFRQLLKPVT 78 +G IA+YQL+QVCQAEYFRQLLKPVT Sbjct: 23 VGVIAYYQLVQVCQAEYFRQLLKPVT 48 >ref|XP_011085262.1| transcription factor bHLH144 [Sesamum indicum] ref|XP_011085263.1| transcription factor bHLH144 [Sesamum indicum] ref|XP_011085264.1| transcription factor bHLH144 [Sesamum indicum] Length = 235 Score = 53.9 bits (128), Expect = 8e-06 Identities = 23/33 (69%), Positives = 26/33 (78%) Frame = +1 Query: 325 MNSNQPYFPGQPMQPLADQYGYYTQNAPMASVF 423 M+S+QPYFP +PM PL DQ GYY QN PMAS F Sbjct: 1 MHSDQPYFPRKPMLPLCDQVGYYMQNPPMASAF 33 >ref|XP_011096522.1| transcription factor bHLH144 [Sesamum indicum] ref|XP_011096525.1| transcription factor bHLH144 [Sesamum indicum] ref|XP_011096526.1| transcription factor bHLH144 [Sesamum indicum] ref|XP_020554104.1| transcription factor bHLH144 [Sesamum indicum] Length = 237 Score = 53.9 bits (128), Expect = 8e-06 Identities = 22/32 (68%), Positives = 29/32 (90%) Frame = +1 Query: 325 MNSNQPYFPGQPMQPLADQYGYYTQNAPMASV 420 M+S+QP+F G+PMQPLADQ+ YY QNAPM+S+ Sbjct: 1 MHSHQPHFSGKPMQPLADQFDYYMQNAPMSSL 32