BLASTX nr result
ID: Rehmannia29_contig00028666
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00028666 (494 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_024019498.1| E3 ubiquitin-protein ligase CCNB1IP1 homolog... 58 6e-07 ref|XP_024019497.1| E3 ubiquitin-protein ligase CCNB1IP1 homolog... 58 6e-07 ref|XP_024019496.1| E3 ubiquitin-protein ligase CCNB1IP1 homolog... 58 7e-07 ref|XP_024019492.1| E3 ubiquitin-protein ligase CCNB1IP1 homolog... 58 7e-07 gb|KDO41163.1| hypothetical protein CISIN_1g0221261mg, partial [... 54 7e-07 gb|EXB54074.1| hypothetical protein L484_017511 [Morus notabilis] 58 7e-07 gb|PKI60067.1| hypothetical protein CRG98_019552 [Punica granatum] 57 1e-06 gb|EEE56612.1| hypothetical protein OsJ_05990 [Oryza sativa Japo... 57 2e-06 ref|XP_016546811.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1... 57 2e-06 gb|AQK94632.1| E3 ubiquitin-protein ligase CCNB1IP1-like protein... 54 3e-06 ref|XP_023888206.1| E3 ubiquitin-protein ligase CCNB1IP1 homolog... 56 3e-06 ref|XP_023888205.1| E3 ubiquitin-protein ligase CCNB1IP1 homolog... 56 3e-06 ref|XP_023888202.1| E3 ubiquitin-protein ligase CCNB1IP1 homolog... 56 3e-06 ref|XP_023888201.1| E3 ubiquitin-protein ligase CCNB1IP1 homolog... 56 3e-06 ref|XP_016546818.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1... 56 3e-06 gb|PIA25938.1| hypothetical protein AQUCO_10200005v1 [Aquilegia ... 55 3e-06 ref|XP_016546804.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1... 56 3e-06 ref|XP_021594281.1| E3 ubiquitin-protein ligase CCNB1IP1 homolog... 56 4e-06 ref|XP_012077767.1| E3 ubiquitin-protein ligase CCNB1IP1 homolog... 56 4e-06 ref|XP_019055151.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1... 56 4e-06 >ref|XP_024019498.1| E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform X4 [Morus notabilis] Length = 300 Score = 58.2 bits (139), Expect = 6e-07 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = -1 Query: 77 AEMRCNACWRELEGRAITTTCGHLL 3 AEMRCNACWRELEGRAITTTCGH+L Sbjct: 3 AEMRCNACWRELEGRAITTTCGHVL 27 >ref|XP_024019497.1| E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform X3 [Morus notabilis] Length = 301 Score = 58.2 bits (139), Expect = 6e-07 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = -1 Query: 77 AEMRCNACWRELEGRAITTTCGHLL 3 AEMRCNACWRELEGRAITTTCGH+L Sbjct: 3 AEMRCNACWRELEGRAITTTCGHVL 27 >ref|XP_024019496.1| E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform X2 [Morus notabilis] Length = 310 Score = 58.2 bits (139), Expect = 7e-07 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = -1 Query: 77 AEMRCNACWRELEGRAITTTCGHLL 3 AEMRCNACWRELEGRAITTTCGH+L Sbjct: 3 AEMRCNACWRELEGRAITTTCGHVL 27 >ref|XP_024019492.1| E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform X1 [Morus notabilis] ref|XP_024019493.1| E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform X1 [Morus notabilis] ref|XP_024019494.1| E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform X1 [Morus notabilis] ref|XP_024019495.1| E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform X1 [Morus notabilis] Length = 311 Score = 58.2 bits (139), Expect = 7e-07 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = -1 Query: 77 AEMRCNACWRELEGRAITTTCGHLL 3 AEMRCNACWRELEGRAITTTCGH+L Sbjct: 3 AEMRCNACWRELEGRAITTTCGHVL 27 >gb|KDO41163.1| hypothetical protein CISIN_1g0221261mg, partial [Citrus sinensis] Length = 73 Score = 54.3 bits (129), Expect = 7e-07 Identities = 22/23 (95%), Positives = 23/23 (100%) Frame = -1 Query: 71 MRCNACWRELEGRAITTTCGHLL 3 MRCNACWRELEGRAI+TTCGHLL Sbjct: 1 MRCNACWRELEGRAISTTCGHLL 23 >gb|EXB54074.1| hypothetical protein L484_017511 [Morus notabilis] Length = 346 Score = 58.2 bits (139), Expect = 7e-07 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = -1 Query: 77 AEMRCNACWRELEGRAITTTCGHLL 3 AEMRCNACWRELEGRAITTTCGH+L Sbjct: 3 AEMRCNACWRELEGRAITTTCGHVL 27 >gb|PKI60067.1| hypothetical protein CRG98_019552 [Punica granatum] Length = 294 Score = 57.4 bits (137), Expect = 1e-06 Identities = 23/25 (92%), Positives = 25/25 (100%) Frame = -1 Query: 77 AEMRCNACWRELEGRAITTTCGHLL 3 AEMRCNACWRELEGRA++TTCGHLL Sbjct: 3 AEMRCNACWRELEGRAVSTTCGHLL 27 >gb|EEE56612.1| hypothetical protein OsJ_05990 [Oryza sativa Japonica Group] Length = 336 Score = 56.6 bits (135), Expect = 2e-06 Identities = 23/47 (48%), Positives = 36/47 (76%) Frame = -1 Query: 143 EKNVTSSRFFTIEK*M*IIIVKAEMRCNACWRELEGRAITTTCGHLL 3 +K + + F I + ++V+++M+CNACWRELEG+A++TTCGHLL Sbjct: 10 KKAMEADMFLRITSSVLNLLVRSKMKCNACWRELEGQAVSTTCGHLL 56 >ref|XP_016546811.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform X4 [Capsicum annuum] Length = 344 Score = 56.6 bits (135), Expect = 2e-06 Identities = 22/27 (81%), Positives = 26/27 (96%) Frame = -1 Query: 86 IVKAEMRCNACWRELEGRAITTTCGHL 6 +V+ EMRCNACWRELEG+AITTTCGH+ Sbjct: 34 LVEVEMRCNACWRELEGQAITTTCGHI 60 >gb|AQK94632.1| E3 ubiquitin-protein ligase CCNB1IP1-like protein [Zea mays] Length = 117 Score = 53.9 bits (128), Expect = 3e-06 Identities = 20/30 (66%), Positives = 28/30 (93%) Frame = -1 Query: 92 IIIVKAEMRCNACWRELEGRAITTTCGHLL 3 +II + +M+CNACWR+LEG+A++TTCGHLL Sbjct: 32 LIICRNKMKCNACWRDLEGQAVSTTCGHLL 61 >ref|XP_023888206.1| E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform X5 [Quercus suber] Length = 298 Score = 56.2 bits (134), Expect = 3e-06 Identities = 23/24 (95%), Positives = 24/24 (100%) Frame = -1 Query: 74 EMRCNACWRELEGRAITTTCGHLL 3 EMRCNACWRELEGRAI+TTCGHLL Sbjct: 4 EMRCNACWRELEGRAISTTCGHLL 27 >ref|XP_023888205.1| E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform X4 [Quercus suber] gb|POE66550.1| e3 ubiquitin-protein ligase ccnb1ip1 like [Quercus suber] Length = 299 Score = 56.2 bits (134), Expect = 3e-06 Identities = 23/24 (95%), Positives = 24/24 (100%) Frame = -1 Query: 74 EMRCNACWRELEGRAITTTCGHLL 3 EMRCNACWRELEGRAI+TTCGHLL Sbjct: 4 EMRCNACWRELEGRAISTTCGHLL 27 >ref|XP_023888202.1| E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform X2 [Quercus suber] Length = 308 Score = 56.2 bits (134), Expect = 3e-06 Identities = 23/24 (95%), Positives = 24/24 (100%) Frame = -1 Query: 74 EMRCNACWRELEGRAITTTCGHLL 3 EMRCNACWRELEGRAI+TTCGHLL Sbjct: 4 EMRCNACWRELEGRAISTTCGHLL 27 >ref|XP_023888201.1| E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform X1 [Quercus suber] gb|POE66551.1| e3 ubiquitin-protein ligase ccnb1ip1 like [Quercus suber] Length = 309 Score = 56.2 bits (134), Expect = 3e-06 Identities = 23/24 (95%), Positives = 24/24 (100%) Frame = -1 Query: 74 EMRCNACWRELEGRAITTTCGHLL 3 EMRCNACWRELEGRAI+TTCGHLL Sbjct: 4 EMRCNACWRELEGRAISTTCGHLL 27 >ref|XP_016546818.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform X5 [Capsicum annuum] Length = 329 Score = 56.2 bits (134), Expect = 3e-06 Identities = 22/26 (84%), Positives = 25/26 (96%) Frame = -1 Query: 83 VKAEMRCNACWRELEGRAITTTCGHL 6 +K EMRCNACWRELEG+AITTTCGH+ Sbjct: 20 LKVEMRCNACWRELEGQAITTTCGHI 45 >gb|PIA25938.1| hypothetical protein AQUCO_10200005v1 [Aquilegia coerulea] Length = 216 Score = 55.5 bits (132), Expect = 3e-06 Identities = 22/23 (95%), Positives = 23/23 (100%) Frame = -1 Query: 71 MRCNACWRELEGRAITTTCGHLL 3 MRCNACWRELEGRA+TTTCGHLL Sbjct: 1 MRCNACWRELEGRAVTTTCGHLL 23 >ref|XP_016546804.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform X3 [Capsicum annuum] Length = 348 Score = 56.2 bits (134), Expect = 3e-06 Identities = 22/26 (84%), Positives = 25/26 (96%) Frame = -1 Query: 83 VKAEMRCNACWRELEGRAITTTCGHL 6 +K EMRCNACWRELEG+AITTTCGH+ Sbjct: 39 LKVEMRCNACWRELEGQAITTTCGHI 64 >ref|XP_021594281.1| E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform X4 [Manihot esculenta] Length = 294 Score = 55.8 bits (133), Expect = 4e-06 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -1 Query: 71 MRCNACWRELEGRAITTTCGHLL 3 MRCNACWRELEGRAITTTCGHLL Sbjct: 1 MRCNACWRELEGRAITTTCGHLL 23 >ref|XP_012077767.1| E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform X4 [Jatropha curcas] Length = 294 Score = 55.8 bits (133), Expect = 4e-06 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -1 Query: 71 MRCNACWRELEGRAITTTCGHLL 3 MRCNACWRELEGRAITTTCGHLL Sbjct: 1 MRCNACWRELEGRAITTTCGHLL 23 >ref|XP_019055151.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform X4 [Nelumbo nucifera] Length = 294 Score = 55.8 bits (133), Expect = 4e-06 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -1 Query: 71 MRCNACWRELEGRAITTTCGHLL 3 MRCNACWRELEGRAITTTCGHLL Sbjct: 1 MRCNACWRELEGRAITTTCGHLL 23