BLASTX nr result
ID: Rehmannia29_contig00028589
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00028589 (499 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022869143.1| cold-responsive protein kinase 1-like, parti... 60 2e-07 >ref|XP_022869143.1| cold-responsive protein kinase 1-like, partial [Olea europaea var. sylvestris] Length = 281 Score = 59.7 bits (143), Expect = 2e-07 Identities = 28/34 (82%), Positives = 33/34 (97%), Gaps = 1/34 (2%) Frame = -3 Query: 101 MTCLSFLCGRRLDSATKHS-DLDNELSGVHNVNL 3 MTCLSFLCGR+LDSAT+HS +L++ELSGVHNVNL Sbjct: 1 MTCLSFLCGRKLDSATRHSPELNDELSGVHNVNL 34