BLASTX nr result
ID: Rehmannia29_contig00028523
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00028523 (412 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012846142.1| PREDICTED: U-box domain-containing protein 1... 97 1e-20 ref|XP_012846140.1| PREDICTED: U-box domain-containing protein 1... 97 1e-20 ref|XP_011070638.1| U-box domain-containing protein 11-like [Ses... 95 5e-20 ref|XP_018625162.1| PREDICTED: U-box domain-containing protein 1... 93 3e-19 ref|XP_016462844.1| PREDICTED: U-box domain-containing protein 1... 93 3e-19 ref|XP_009797524.1| PREDICTED: U-box domain-containing protein 1... 93 3e-19 ref|XP_009596674.1| PREDICTED: U-box domain-containing protein 1... 93 3e-19 ref|XP_016502776.1| PREDICTED: U-box domain-containing protein 1... 93 3e-19 ref|XP_019164767.1| PREDICTED: U-box domain-containing protein 1... 92 4e-19 gb|PON78732.1| Beta-catenin [Parasponia andersonii] 92 6e-19 gb|PON98188.1| Beta-catenin [Trema orientalis] 92 6e-19 dbj|GAV85328.1| Arm domain-containing protein/U-box domain-conta... 91 2e-18 gb|KZV18494.1| U-box domain-containing protein 10-like [Dorcocer... 91 2e-18 ref|XP_019266597.1| PREDICTED: U-box domain-containing protein 1... 90 3e-18 ref|XP_009630244.1| PREDICTED: U-box domain-containing protein 1... 90 3e-18 gb|PNT15952.1| hypothetical protein POPTR_010G113900v3 [Populus ... 90 3e-18 gb|PNT15953.1| hypothetical protein POPTR_010G113900v3 [Populus ... 90 4e-18 ref|XP_011038670.1| PREDICTED: U-box domain-containing protein 1... 90 4e-18 gb|PNT15954.1| hypothetical protein POPTR_010G113900v3 [Populus ... 90 4e-18 ref|XP_011038668.1| PREDICTED: U-box domain-containing protein 1... 90 4e-18 >ref|XP_012846142.1| PREDICTED: U-box domain-containing protein 11 isoform X2 [Erythranthe guttata] Length = 646 Score = 97.1 bits (240), Expect = 1e-20 Identities = 49/54 (90%), Positives = 52/54 (96%) Frame = -1 Query: 412 AILLSLCKRDKENLACLSRLGALIPLSELAKNGTERAKRKANSLLENLRKSQQL 251 AILLSLCKRDKENLACLSRLG +IPL+ELAKNGTERAKRKA+SLLENLRK QQL Sbjct: 593 AILLSLCKRDKENLACLSRLGGVIPLTELAKNGTERAKRKASSLLENLRKLQQL 646 >ref|XP_012846140.1| PREDICTED: U-box domain-containing protein 11 isoform X1 [Erythranthe guttata] gb|EYU30050.1| hypothetical protein MIMGU_mgv1a002663mg [Erythranthe guttata] Length = 649 Score = 97.1 bits (240), Expect = 1e-20 Identities = 49/54 (90%), Positives = 52/54 (96%) Frame = -1 Query: 412 AILLSLCKRDKENLACLSRLGALIPLSELAKNGTERAKRKANSLLENLRKSQQL 251 AILLSLCKRDKENLACLSRLG +IPL+ELAKNGTERAKRKA+SLLENLRK QQL Sbjct: 596 AILLSLCKRDKENLACLSRLGGVIPLTELAKNGTERAKRKASSLLENLRKLQQL 649 >ref|XP_011070638.1| U-box domain-containing protein 11-like [Sesamum indicum] Length = 652 Score = 95.1 bits (235), Expect = 5e-20 Identities = 48/53 (90%), Positives = 51/53 (96%) Frame = -1 Query: 412 AILLSLCKRDKENLACLSRLGALIPLSELAKNGTERAKRKANSLLENLRKSQQ 254 AILLSLCKRD ENLACLSRLGA+IPLSELA+NGTERAKRKA SLLE+LRKSQQ Sbjct: 599 AILLSLCKRDNENLACLSRLGAVIPLSELARNGTERAKRKATSLLEHLRKSQQ 651 >ref|XP_018625162.1| PREDICTED: U-box domain-containing protein 10-like isoform X2 [Nicotiana tomentosiformis] Length = 548 Score = 92.8 bits (229), Expect = 3e-19 Identities = 48/54 (88%), Positives = 50/54 (92%) Frame = -1 Query: 412 AILLSLCKRDKENLACLSRLGALIPLSELAKNGTERAKRKANSLLENLRKSQQL 251 AILLSLCKRD ENLACL RLGA+IPLSELAK+GTERAKRKA SLLE LRKSQQL Sbjct: 495 AILLSLCKRDSENLACLCRLGAVIPLSELAKSGTERAKRKATSLLEYLRKSQQL 548 >ref|XP_016462844.1| PREDICTED: U-box domain-containing protein 10-like [Nicotiana tabacum] Length = 593 Score = 92.8 bits (229), Expect = 3e-19 Identities = 48/54 (88%), Positives = 50/54 (92%) Frame = -1 Query: 412 AILLSLCKRDKENLACLSRLGALIPLSELAKNGTERAKRKANSLLENLRKSQQL 251 AILLSLCKRD ENLACL RLGA+IPLSELAK+GTERAKRKA SLLE LRKSQQL Sbjct: 540 AILLSLCKRDSENLACLCRLGAVIPLSELAKSGTERAKRKATSLLEYLRKSQQL 593 >ref|XP_009797524.1| PREDICTED: U-box domain-containing protein 11-like [Nicotiana sylvestris] Length = 642 Score = 92.8 bits (229), Expect = 3e-19 Identities = 48/54 (88%), Positives = 50/54 (92%) Frame = -1 Query: 412 AILLSLCKRDKENLACLSRLGALIPLSELAKNGTERAKRKANSLLENLRKSQQL 251 AILLSLCKRD ENLACL RLGA+IPLSELAK+GTERAKRKA SLLE LRKSQQL Sbjct: 589 AILLSLCKRDSENLACLCRLGAVIPLSELAKSGTERAKRKATSLLEYLRKSQQL 642 >ref|XP_009596674.1| PREDICTED: U-box domain-containing protein 10-like isoform X1 [Nicotiana tomentosiformis] Length = 645 Score = 92.8 bits (229), Expect = 3e-19 Identities = 48/54 (88%), Positives = 50/54 (92%) Frame = -1 Query: 412 AILLSLCKRDKENLACLSRLGALIPLSELAKNGTERAKRKANSLLENLRKSQQL 251 AILLSLCKRD ENLACL RLGA+IPLSELAK+GTERAKRKA SLLE LRKSQQL Sbjct: 592 AILLSLCKRDSENLACLCRLGAVIPLSELAKSGTERAKRKATSLLEYLRKSQQL 645 >ref|XP_016502776.1| PREDICTED: U-box domain-containing protein 11-like [Nicotiana tabacum] Length = 646 Score = 92.8 bits (229), Expect = 3e-19 Identities = 48/54 (88%), Positives = 50/54 (92%) Frame = -1 Query: 412 AILLSLCKRDKENLACLSRLGALIPLSELAKNGTERAKRKANSLLENLRKSQQL 251 AILLSLCKRD ENLACL RLGA+IPLSELAK+GTERAKRKA SLLE LRKSQQL Sbjct: 593 AILLSLCKRDSENLACLCRLGAVIPLSELAKSGTERAKRKATSLLEYLRKSQQL 646 >ref|XP_019164767.1| PREDICTED: U-box domain-containing protein 11-like [Ipomoea nil] Length = 660 Score = 92.4 bits (228), Expect = 4e-19 Identities = 46/54 (85%), Positives = 52/54 (96%) Frame = -1 Query: 412 AILLSLCKRDKENLACLSRLGALIPLSELAKNGTERAKRKANSLLENLRKSQQL 251 AILLSLCKRD ENLACLSRLGA+IPL+EL+K+GTERAKRKA SLLE+LRK+QQL Sbjct: 607 AILLSLCKRDSENLACLSRLGAVIPLTELSKSGTERAKRKATSLLEHLRKAQQL 660 >gb|PON78732.1| Beta-catenin [Parasponia andersonii] Length = 664 Score = 92.0 bits (227), Expect = 6e-19 Identities = 46/54 (85%), Positives = 51/54 (94%) Frame = -1 Query: 412 AILLSLCKRDKENLACLSRLGALIPLSELAKNGTERAKRKANSLLENLRKSQQL 251 AILL+LCKRD ENLAC+SRLGA+IPL+ELAKNGTERAKRKA SLLE+LRK QQL Sbjct: 611 AILLALCKRDTENLACISRLGAVIPLTELAKNGTERAKRKATSLLEHLRKLQQL 664 >gb|PON98188.1| Beta-catenin [Trema orientalis] Length = 668 Score = 92.0 bits (227), Expect = 6e-19 Identities = 46/54 (85%), Positives = 51/54 (94%) Frame = -1 Query: 412 AILLSLCKRDKENLACLSRLGALIPLSELAKNGTERAKRKANSLLENLRKSQQL 251 AILL+LCKRD ENLAC+SRLGA+IPL+ELAKNGTERAKRKA SLLE+LRK QQL Sbjct: 615 AILLALCKRDTENLACISRLGAVIPLTELAKNGTERAKRKATSLLEHLRKLQQL 668 >dbj|GAV85328.1| Arm domain-containing protein/U-box domain-containing protein [Cephalotus follicularis] Length = 625 Score = 90.5 bits (223), Expect = 2e-18 Identities = 45/54 (83%), Positives = 50/54 (92%) Frame = -1 Query: 412 AILLSLCKRDKENLACLSRLGALIPLSELAKNGTERAKRKANSLLENLRKSQQL 251 +ILLSLCKRD ENL C+SRLGA+IPL+ELAK+GTERAKRKA SLLENLRK QQL Sbjct: 572 SILLSLCKRDSENLECISRLGAVIPLTELAKSGTERAKRKAGSLLENLRKLQQL 625 >gb|KZV18494.1| U-box domain-containing protein 10-like [Dorcoceras hygrometricum] Length = 645 Score = 90.5 bits (223), Expect = 2e-18 Identities = 46/54 (85%), Positives = 50/54 (92%) Frame = -1 Query: 412 AILLSLCKRDKENLACLSRLGALIPLSELAKNGTERAKRKANSLLENLRKSQQL 251 AILLSLCKRD ENL CLSRLGA+IPL+ELA+NGTERAKRKA SLLE+L KSQQL Sbjct: 592 AILLSLCKRDNENLGCLSRLGAVIPLTELAENGTERAKRKATSLLEHLCKSQQL 645 >ref|XP_019266597.1| PREDICTED: U-box domain-containing protein 11-like [Nicotiana attenuata] gb|OIT05555.1| u-box domain-containing protein 10 [Nicotiana attenuata] Length = 645 Score = 90.1 bits (222), Expect = 3e-18 Identities = 46/53 (86%), Positives = 49/53 (92%) Frame = -1 Query: 412 AILLSLCKRDKENLACLSRLGALIPLSELAKNGTERAKRKANSLLENLRKSQQ 254 AILLSLCKRD ENL+CL RLGALIPLSELA +GTERAKRKA SLLE+LRKSQQ Sbjct: 592 AILLSLCKRDPENLSCLRRLGALIPLSELANSGTERAKRKATSLLEHLRKSQQ 644 >ref|XP_009630244.1| PREDICTED: U-box domain-containing protein 11-like [Nicotiana tomentosiformis] ref|XP_016437275.1| PREDICTED: U-box domain-containing protein 11-like [Nicotiana tabacum] Length = 645 Score = 90.1 bits (222), Expect = 3e-18 Identities = 46/53 (86%), Positives = 49/53 (92%) Frame = -1 Query: 412 AILLSLCKRDKENLACLSRLGALIPLSELAKNGTERAKRKANSLLENLRKSQQ 254 AILLSLCKRD ENL+CL RLGALIPLSELA +GTERAKRKA SLLE+LRKSQQ Sbjct: 592 AILLSLCKRDPENLSCLRRLGALIPLSELANSGTERAKRKATSLLEHLRKSQQ 644 >gb|PNT15952.1| hypothetical protein POPTR_010G113900v3 [Populus trichocarpa] Length = 453 Score = 89.7 bits (221), Expect = 3e-18 Identities = 44/53 (83%), Positives = 50/53 (94%) Frame = -1 Query: 412 AILLSLCKRDKENLACLSRLGALIPLSELAKNGTERAKRKANSLLENLRKSQQ 254 AILLSLCKRD ENLAC+SRLGA+IPL+ELAKNGTERAKRKA S+LE+LR+ QQ Sbjct: 400 AILLSLCKRDPENLACISRLGAVIPLTELAKNGTERAKRKATSMLEHLRRLQQ 452 >gb|PNT15953.1| hypothetical protein POPTR_010G113900v3 [Populus trichocarpa] Length = 571 Score = 89.7 bits (221), Expect = 4e-18 Identities = 44/53 (83%), Positives = 50/53 (94%) Frame = -1 Query: 412 AILLSLCKRDKENLACLSRLGALIPLSELAKNGTERAKRKANSLLENLRKSQQ 254 AILLSLCKRD ENLAC+SRLGA+IPL+ELAKNGTERAKRKA S+LE+LR+ QQ Sbjct: 518 AILLSLCKRDPENLACISRLGAVIPLTELAKNGTERAKRKATSMLEHLRRLQQ 570 >ref|XP_011038670.1| PREDICTED: U-box domain-containing protein 11-like isoform X2 [Populus euphratica] Length = 571 Score = 89.7 bits (221), Expect = 4e-18 Identities = 44/53 (83%), Positives = 50/53 (94%) Frame = -1 Query: 412 AILLSLCKRDKENLACLSRLGALIPLSELAKNGTERAKRKANSLLENLRKSQQ 254 AILLSLCKRD ENLAC+SRLGA+IPL+ELAKNGTERAKRKA S+LE+LR+ QQ Sbjct: 518 AILLSLCKRDPENLACISRLGAVIPLTELAKNGTERAKRKATSMLEHLRRLQQ 570 >gb|PNT15954.1| hypothetical protein POPTR_010G113900v3 [Populus trichocarpa] Length = 640 Score = 89.7 bits (221), Expect = 4e-18 Identities = 44/53 (83%), Positives = 50/53 (94%) Frame = -1 Query: 412 AILLSLCKRDKENLACLSRLGALIPLSELAKNGTERAKRKANSLLENLRKSQQ 254 AILLSLCKRD ENLAC+SRLGA+IPL+ELAKNGTERAKRKA S+LE+LR+ QQ Sbjct: 587 AILLSLCKRDPENLACISRLGAVIPLTELAKNGTERAKRKATSMLEHLRRLQQ 639 >ref|XP_011038668.1| PREDICTED: U-box domain-containing protein 11-like isoform X1 [Populus euphratica] Length = 640 Score = 89.7 bits (221), Expect = 4e-18 Identities = 44/53 (83%), Positives = 50/53 (94%) Frame = -1 Query: 412 AILLSLCKRDKENLACLSRLGALIPLSELAKNGTERAKRKANSLLENLRKSQQ 254 AILLSLCKRD ENLAC+SRLGA+IPL+ELAKNGTERAKRKA S+LE+LR+ QQ Sbjct: 587 AILLSLCKRDPENLACISRLGAVIPLTELAKNGTERAKRKATSMLEHLRRLQQ 639