BLASTX nr result
ID: Rehmannia29_contig00028485
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00028485 (589 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN12412.1| hypothetical protein CDL12_14976 [Handroanthus im... 59 1e-06 ref|XP_020553954.1| AP-5 complex subunit zeta-1 [Sesamum indicum] 57 5e-06 >gb|PIN12412.1| hypothetical protein CDL12_14976 [Handroanthus impetiginosus] gb|PIN17359.1| hypothetical protein CDL12_09981 [Handroanthus impetiginosus] Length = 567 Score = 58.9 bits (141), Expect = 1e-06 Identities = 29/39 (74%), Positives = 34/39 (87%), Gaps = 1/39 (2%) Frame = +2 Query: 2 PVVAEATLEFLSSNKRKLLKTFPTLLPQVY-IMINSCSW 115 PVVAEATLEFLSSNKRKLLK+FPTLLPQ + +M+ +W Sbjct: 120 PVVAEATLEFLSSNKRKLLKSFPTLLPQFFPLMLKLIAW 158 >ref|XP_020553954.1| AP-5 complex subunit zeta-1 [Sesamum indicum] Length = 567 Score = 57.0 bits (136), Expect = 5e-06 Identities = 28/39 (71%), Positives = 33/39 (84%), Gaps = 1/39 (2%) Frame = +2 Query: 2 PVVAEATLEFLSSNKRKLLKTFPTLLPQVY-IMINSCSW 115 PVVAEATLEFLSSNK KLLK+FPTLLPQ + +M+ +W Sbjct: 120 PVVAEATLEFLSSNKEKLLKSFPTLLPQFFPLMLKLIAW 158