BLASTX nr result
ID: Rehmannia29_contig00028470
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00028470 (515 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDO37685.1| hypothetical protein CISIN_1g034815mg [Citrus sin... 60 6e-09 ref|XP_019243603.1| PREDICTED: FKBP12-interacting protein of 37 ... 58 9e-07 ref|XP_016512916.1| PREDICTED: FKBP12-interacting protein of 37 ... 58 9e-07 ref|XP_009601032.1| PREDICTED: FKBP12-interacting protein of 37 ... 58 9e-07 gb|PPS19393.1| hypothetical protein GOBAR_AA01192 [Gossypium bar... 58 1e-06 ref|XP_016713123.1| PREDICTED: FKBP12-interacting protein of 37 ... 58 1e-06 ref|XP_017646005.1| PREDICTED: FKBP12-interacting protein of 37 ... 58 1e-06 emb|CDP16955.1| unnamed protein product [Coffea canephora] 54 1e-06 gb|KHG16781.1| FKBP12-interacting of 37 kDa -like protein [Gossy... 58 1e-06 gb|KJB08217.1| hypothetical protein B456_001G071300 [Gossypium r... 57 1e-06 gb|KDO69530.1| hypothetical protein CISIN_1g0193661mg, partial [... 54 1e-06 gb|PPD90323.1| hypothetical protein GOBAR_DD12725 [Gossypium bar... 57 2e-06 ref|XP_011072168.1| FKBP12-interacting protein of 37 kDa, partia... 57 2e-06 gb|KJB08219.1| hypothetical protein B456_001G071300 [Gossypium r... 57 2e-06 ref|XP_016744365.1| PREDICTED: FKBP12-interacting protein of 37 ... 57 2e-06 ref|XP_012469411.1| PREDICTED: FKBP12-interacting protein of 37 ... 57 2e-06 ref|XP_021292178.1| FKBP12-interacting protein of 37 kDa isoform... 57 2e-06 gb|KVH98194.1| hypothetical protein Ccrd_023591 [Cynara carduncu... 57 2e-06 ref|XP_007036370.1| PREDICTED: FKBP12-interacting protein of 37 ... 57 2e-06 ref|XP_009774199.1| PREDICTED: FKBP12-interacting protein of 37 ... 57 2e-06 >gb|KDO37685.1| hypothetical protein CISIN_1g034815mg [Citrus sinensis] Length = 82 Score = 60.1 bits (144), Expect = 6e-09 Identities = 29/42 (69%), Positives = 34/42 (80%) Frame = +2 Query: 2 DIFGSKKGNLKVEETAPGVATGMILSLRERYCFVLNLVFFSA 127 DIFGS+K N KVEETAPGVATGMILSLRER+ + +F+A Sbjct: 41 DIFGSRKANSKVEETAPGVATGMILSLRERFYKTTEISYFAA 82 >ref|XP_019243603.1| PREDICTED: FKBP12-interacting protein of 37 kDa [Nicotiana attenuata] gb|OIT04835.1| fkbp12-interacting protein of 37 kda [Nicotiana attenuata] Length = 341 Score = 58.2 bits (139), Expect = 9e-07 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = +2 Query: 2 DIFGSKKGNLKVEETAPGVATGMILSLRE 88 DIFGSKKGNLKVEETAPG ATGMILSLRE Sbjct: 38 DIFGSKKGNLKVEETAPGAATGMILSLRE 66 >ref|XP_016512916.1| PREDICTED: FKBP12-interacting protein of 37 kDa-like [Nicotiana tabacum] Length = 341 Score = 58.2 bits (139), Expect = 9e-07 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = +2 Query: 2 DIFGSKKGNLKVEETAPGVATGMILSLRE 88 DIFGSKKGNLKVEETAPG ATGMILSLRE Sbjct: 38 DIFGSKKGNLKVEETAPGAATGMILSLRE 66 >ref|XP_009601032.1| PREDICTED: FKBP12-interacting protein of 37 kDa [Nicotiana tomentosiformis] Length = 341 Score = 58.2 bits (139), Expect = 9e-07 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = +2 Query: 2 DIFGSKKGNLKVEETAPGVATGMILSLRE 88 DIFGSKKGNLKVEETAPG ATGMILSLRE Sbjct: 38 DIFGSKKGNLKVEETAPGAATGMILSLRE 66 >gb|PPS19393.1| hypothetical protein GOBAR_AA01192 [Gossypium barbadense] Length = 321 Score = 57.8 bits (138), Expect = 1e-06 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = +2 Query: 2 DIFGSKKGNLKVEETAPGVATGMILSLRE 88 DIFGSKKGN KVEETAPGVATGMILSLRE Sbjct: 60 DIFGSKKGNTKVEETAPGVATGMILSLRE 88 >ref|XP_016713123.1| PREDICTED: FKBP12-interacting protein of 37 kDa-like [Gossypium hirsutum] Length = 346 Score = 57.8 bits (138), Expect = 1e-06 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = +2 Query: 2 DIFGSKKGNLKVEETAPGVATGMILSLRE 88 DIFGSKKGN KVEETAPGVATGMILSLRE Sbjct: 41 DIFGSKKGNTKVEETAPGVATGMILSLRE 69 >ref|XP_017646005.1| PREDICTED: FKBP12-interacting protein of 37 kDa [Gossypium arboreum] Length = 347 Score = 57.8 bits (138), Expect = 1e-06 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = +2 Query: 2 DIFGSKKGNLKVEETAPGVATGMILSLRE 88 DIFGSKKGN KVEETAPGVATGMILSLRE Sbjct: 41 DIFGSKKGNTKVEETAPGVATGMILSLRE 69 >emb|CDP16955.1| unnamed protein product [Coffea canephora] Length = 89 Score = 54.3 bits (129), Expect = 1e-06 Identities = 26/29 (89%), Positives = 26/29 (89%) Frame = +2 Query: 2 DIFGSKKGNLKVEETAPGVATGMILSLRE 88 D FGSKKG LK EETAPGVATGMILSLRE Sbjct: 37 DFFGSKKGKLKAEETAPGVATGMILSLRE 65 >gb|KHG16781.1| FKBP12-interacting of 37 kDa -like protein [Gossypium arboreum] Length = 397 Score = 57.8 bits (138), Expect = 1e-06 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = +2 Query: 2 DIFGSKKGNLKVEETAPGVATGMILSLRE 88 DIFGSKKGN KVEETAPGVATGMILSLRE Sbjct: 91 DIFGSKKGNTKVEETAPGVATGMILSLRE 119 >gb|KJB08217.1| hypothetical protein B456_001G071300 [Gossypium raimondii] Length = 302 Score = 57.4 bits (137), Expect = 1e-06 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = +2 Query: 2 DIFGSKKGNLKVEETAPGVATGMILSLRE 88 DIFGSKKGN KVEETAPGVATGMILSLRE Sbjct: 41 DIFGSKKGNSKVEETAPGVATGMILSLRE 69 >gb|KDO69530.1| hypothetical protein CISIN_1g0193661mg, partial [Citrus sinensis] gb|KDO69531.1| hypothetical protein CISIN_1g0193661mg, partial [Citrus sinensis] Length = 82 Score = 53.9 bits (128), Expect = 1e-06 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = +2 Query: 2 DIFGSKKGNLKVEETAPGVATGMILSLRE 88 DIFGS+K N KVEETAPGVATGMILSLRE Sbjct: 41 DIFGSRKANSKVEETAPGVATGMILSLRE 69 >gb|PPD90323.1| hypothetical protein GOBAR_DD12725 [Gossypium barbadense] gb|PPR82439.1| hypothetical protein GOBAR_AA38274 [Gossypium barbadense] Length = 328 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = +2 Query: 2 DIFGSKKGNLKVEETAPGVATGMILSLRE 88 DIFGSKKGN KVEETAPGVATGMILSLRE Sbjct: 41 DIFGSKKGNSKVEETAPGVATGMILSLRE 69 >ref|XP_011072168.1| FKBP12-interacting protein of 37 kDa, partial [Sesamum indicum] Length = 329 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = +2 Query: 2 DIFGSKKGNLKVEETAPGVATGMILSLRE 88 DIFGSKK NLKVEETAPGVATGMILSLRE Sbjct: 41 DIFGSKKANLKVEETAPGVATGMILSLRE 69 >gb|KJB08219.1| hypothetical protein B456_001G071300 [Gossypium raimondii] Length = 340 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = +2 Query: 2 DIFGSKKGNLKVEETAPGVATGMILSLRE 88 DIFGSKKGN KVEETAPGVATGMILSLRE Sbjct: 35 DIFGSKKGNSKVEETAPGVATGMILSLRE 63 >ref|XP_016744365.1| PREDICTED: FKBP12-interacting protein of 37 kDa-like [Gossypium hirsutum] Length = 346 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = +2 Query: 2 DIFGSKKGNLKVEETAPGVATGMILSLRE 88 DIFGSKKGN KVEETAPGVATGMILSLRE Sbjct: 41 DIFGSKKGNSKVEETAPGVATGMILSLRE 69 >ref|XP_012469411.1| PREDICTED: FKBP12-interacting protein of 37 kDa [Gossypium raimondii] gb|KJB08216.1| hypothetical protein B456_001G071300 [Gossypium raimondii] Length = 346 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = +2 Query: 2 DIFGSKKGNLKVEETAPGVATGMILSLRE 88 DIFGSKKGN KVEETAPGVATGMILSLRE Sbjct: 41 DIFGSKKGNSKVEETAPGVATGMILSLRE 69 >ref|XP_021292178.1| FKBP12-interacting protein of 37 kDa isoform X2 [Herrania umbratica] Length = 348 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = +2 Query: 2 DIFGSKKGNLKVEETAPGVATGMILSLRE 88 DIFGSKKGN KVEETAPGVATGMILSLRE Sbjct: 41 DIFGSKKGNSKVEETAPGVATGMILSLRE 69 >gb|KVH98194.1| hypothetical protein Ccrd_023591 [Cynara cardunculus var. scolymus] Length = 348 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = +2 Query: 2 DIFGSKKGNLKVEETAPGVATGMILSLRE 88 DIFGSKK NLKVEETAPGVATGMILSLRE Sbjct: 41 DIFGSKKANLKVEETAPGVATGMILSLRE 69 >ref|XP_007036370.1| PREDICTED: FKBP12-interacting protein of 37 kDa [Theobroma cacao] gb|EOY20871.1| FKBP12-interacting protein of 37 kDa [Theobroma cacao] Length = 348 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = +2 Query: 2 DIFGSKKGNLKVEETAPGVATGMILSLRE 88 DIFGSKKGN KVEETAPGVATGMILSLRE Sbjct: 41 DIFGSKKGNSKVEETAPGVATGMILSLRE 69 >ref|XP_009774199.1| PREDICTED: FKBP12-interacting protein of 37 kDa-like [Nicotiana sylvestris] ref|XP_016445775.1| PREDICTED: FKBP12-interacting protein of 37 kDa-like [Nicotiana tabacum] Length = 334 Score = 57.0 bits (136), Expect = 2e-06 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = +2 Query: 2 DIFGSKKGNLKVEETAPGVATGMILSLRE 88 DIFGSKK NLKVEETAPGVATGMILSLRE Sbjct: 31 DIFGSKKDNLKVEETAPGVATGMILSLRE 59