BLASTX nr result
ID: Rehmannia29_contig00028460
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00028460 (401 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EEF51216.1| conserved hypothetical protein [Ricinus communis] 56 2e-06 >gb|EEF51216.1| conserved hypothetical protein [Ricinus communis] Length = 358 Score = 56.2 bits (134), Expect = 2e-06 Identities = 31/91 (34%), Positives = 49/91 (53%), Gaps = 2/91 (2%) Frame = -3 Query: 342 SYVPENYRSLIQAMITFVIVLHDKAYKSLLNGFSGQNLVVLDGSLKFWKAADPTPV--TM 169 +YVP YR LI++M+TFV+ +HD Y + GF N+V+ + +KFWK T + Sbjct: 111 NYVPNEYRKLIKSMVTFVVDIHDAGYSTA--GFGMPNIVIKNEVVKFWKVQFITASMGSK 168 Query: 168 KNDLR*LYHVPTNKLSTGGYTAIPSDMDHLI 76 ND L+ V + S + +P +M H + Sbjct: 169 NNDFICLHRVVESLFSGEQHLHLPREMQHFL 199