BLASTX nr result
ID: Rehmannia29_contig00028459
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00028459 (416 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EEF51216.1| conserved hypothetical protein [Ricinus communis] 64 3e-09 >gb|EEF51216.1| conserved hypothetical protein [Ricinus communis] Length = 358 Score = 64.3 bits (155), Expect = 3e-09 Identities = 31/91 (34%), Positives = 51/91 (56%) Frame = -2 Query: 355 SYVPENYRSLIQAMITFVIFLHDKAYKSLLNGFSGQNLVVLDGTLKFWKAAFTDPTPVTM 176 +YVP YR LI++M+TFV+ +HD Y + GF N+V+ + +KFWK F + + Sbjct: 111 NYVPNEYRKLIKSMVTFVVDIHDAGYSTA--GFGMPNIVIKNEVVKFWKVQFITASMGSK 168 Query: 175 KNDLR*LYHVLTNKLSTGGYTAIPSDMDHLI 83 ND L+ V+ + S + +P +M H + Sbjct: 169 NNDFICLHRVVESLFSGEQHLHLPREMQHFL 199