BLASTX nr result
ID: Rehmannia29_contig00028431
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00028431 (453 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIM99116.1| Mannosyltransferase [Handroanthus impetiginosus] 56 4e-06 >gb|PIM99116.1| Mannosyltransferase [Handroanthus impetiginosus] Length = 437 Score = 55.8 bits (133), Expect = 4e-06 Identities = 24/31 (77%), Positives = 26/31 (83%) Frame = -1 Query: 453 TFVIINVIHSHVYCPLFKQLQANSSKGTKHD 361 TFVI+N+IHSHVYCPLFKQ QAN SK K D Sbjct: 407 TFVIVNIIHSHVYCPLFKQCQANPSKAMKDD 437