BLASTX nr result
ID: Rehmannia29_contig00028162
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00028162 (411 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN24287.1| hypothetical protein CDL12_02997 [Handroanthus im... 65 2e-09 ref|XP_011096865.1| DDB1- and CUL4-associated factor 4 [Sesamum ... 64 3e-09 gb|KZV21647.1| hypothetical protein F511_16353 [Dorcoceras hygro... 64 3e-09 gb|EYU43621.1| hypothetical protein MIMGU_mgv1a018935mg [Erythra... 59 9e-08 ref|XP_012829683.1| PREDICTED: DDB1- and CUL4-associated factor ... 59 3e-07 >gb|PIN24287.1| hypothetical protein CDL12_02997 [Handroanthus impetiginosus] Length = 386 Score = 64.7 bits (156), Expect = 2e-09 Identities = 29/43 (67%), Positives = 31/43 (72%), Gaps = 8/43 (18%) Frame = +1 Query: 1 AVCWPR-------SGEDV-CYWQEHCWGAWVGSYEGIFYMDWL 105 AVCWPR G+D CYWQEH GAW+GSYEGIFYMDWL Sbjct: 344 AVCWPRIGGIRAKDGQDYRCYWQEHRLGAWLGSYEGIFYMDWL 386 >ref|XP_011096865.1| DDB1- and CUL4-associated factor 4 [Sesamum indicum] Length = 477 Score = 64.3 bits (155), Expect = 3e-09 Identities = 26/45 (57%), Positives = 31/45 (68%), Gaps = 10/45 (22%) Frame = +1 Query: 1 AVCWPRSG----------EDVCYWQEHCWGAWVGSYEGIFYMDWL 105 AVCWPR G + CYWQ+H +GAW+GSYEG+FYMDWL Sbjct: 433 AVCWPRVGGLLELTKDGQDHRCYWQDHSFGAWLGSYEGVFYMDWL 477 >gb|KZV21647.1| hypothetical protein F511_16353 [Dorcoceras hygrometricum] Length = 340 Score = 63.9 bits (154), Expect = 3e-09 Identities = 25/38 (65%), Positives = 29/38 (76%), Gaps = 3/38 (7%) Frame = +1 Query: 1 AVCWPRSGEDV---CYWQEHCWGAWVGSYEGIFYMDWL 105 AVCWPR + CYWQEH +G W+GSYEGI+YMDWL Sbjct: 303 AVCWPRVRDSENYRCYWQEHYFGTWIGSYEGIYYMDWL 340 >gb|EYU43621.1| hypothetical protein MIMGU_mgv1a018935mg [Erythranthe guttata] Length = 190 Score = 58.5 bits (140), Expect = 9e-08 Identities = 26/38 (68%), Positives = 27/38 (71%), Gaps = 3/38 (7%) Frame = +1 Query: 1 AVCWPRSGEDV---CYWQEHCWGAWVGSYEGIFYMDWL 105 AVCW S E YW+EH GAWVGSYEGIFYMDWL Sbjct: 153 AVCWSTSREKEKTRSYWEEHGMGAWVGSYEGIFYMDWL 190 >ref|XP_012829683.1| PREDICTED: DDB1- and CUL4-associated factor 4 [Erythranthe guttata] Length = 469 Score = 58.5 bits (140), Expect = 3e-07 Identities = 26/38 (68%), Positives = 27/38 (71%), Gaps = 3/38 (7%) Frame = +1 Query: 1 AVCWPRSGEDV---CYWQEHCWGAWVGSYEGIFYMDWL 105 AVCW S E YW+EH GAWVGSYEGIFYMDWL Sbjct: 432 AVCWSTSREKEKTRSYWEEHGMGAWVGSYEGIFYMDWL 469