BLASTX nr result
ID: Rehmannia29_contig00028145
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00028145 (450 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020552136.1| BTB/POZ and TAZ domain-containing protein 1 ... 80 3e-15 gb|PIN18300.1| CREB binding protein/P300 [Handroanthus impetigin... 81 3e-15 ref|XP_011086988.1| BTB/POZ and TAZ domain-containing protein 1 ... 80 8e-15 gb|PIN27034.1| CREB binding protein/P300 [Handroanthus impetigin... 76 3e-13 gb|PIN25520.1| CREB binding protein/P300 [Handroanthus impetigin... 74 1e-12 ref|XP_019247444.1| PREDICTED: BTB/POZ and TAZ domain-containing... 72 9e-12 ref|XP_015079907.1| PREDICTED: BTB/POZ and TAZ domain-containing... 71 1e-11 emb|CDP15082.1| unnamed protein product [Coffea canephora] 71 1e-11 ref|XP_006347421.1| PREDICTED: BTB/POZ and TAZ domain-containing... 70 2e-11 ref|XP_004241527.1| PREDICTED: BTB/POZ and TAZ domain-containing... 70 2e-11 ref|XP_009767207.1| PREDICTED: BTB/POZ and TAZ domain-containing... 70 5e-11 gb|EYU17772.1| hypothetical protein MIMGU_mgv1a009657mg [Erythra... 69 1e-10 gb|PHU05308.1| BTB/POZ and TAZ domain-containing protein 1 [Caps... 69 1e-10 gb|PHT63283.1| BTB/POZ and TAZ domain-containing protein 1 [Caps... 69 1e-10 ref|XP_016578245.1| PREDICTED: BTB/POZ and TAZ domain-containing... 69 1e-10 ref|XP_012829228.1| PREDICTED: BTB/POZ and TAZ domain-containing... 69 1e-10 ref|XP_009631253.1| PREDICTED: BTB/POZ and TAZ domain-containing... 68 1e-10 ref|XP_009631252.1| PREDICTED: BTB/POZ and TAZ domain-containing... 68 2e-10 emb|CBI14900.3| unnamed protein product, partial [Vitis vinifera] 67 3e-10 ref|XP_019247443.1| PREDICTED: BTB/POZ and TAZ domain-containing... 67 3e-10 >ref|XP_020552136.1| BTB/POZ and TAZ domain-containing protein 1 isoform X3 [Sesamum indicum] Length = 262 Score = 80.1 bits (196), Expect = 3e-15 Identities = 43/60 (71%), Positives = 49/60 (81%), Gaps = 2/60 (3%) Frame = -1 Query: 450 REFKLKVVQERQRGSDLLWRLLVRKVASAKAI--LSLPKRKREEEPRMDMDHQEMSSFKL 277 R+FKLK Q+ + GSD WRLLVRKVASAKA+ LSLPKRKREEEPRM MD++EM S KL Sbjct: 202 RQFKLKAQQDPRGGSDERWRLLVRKVASAKAMSSLSLPKRKREEEPRMGMDNREMRSIKL 261 >gb|PIN18300.1| CREB binding protein/P300 [Handroanthus impetiginosus] Length = 364 Score = 81.3 bits (199), Expect = 3e-15 Identities = 44/60 (73%), Positives = 52/60 (86%), Gaps = 2/60 (3%) Frame = -1 Query: 450 REFKLKVVQERQRGSDLLWRLLVRKVASAKAI--LSLPKRKREEEPRMDMDHQEMSSFKL 277 R+FKLKV Q+R++ SD W LLVRKV+SAKAI LSLPKRKREE+PRM MDHQ+M+SFKL Sbjct: 306 RQFKLKVQQDRRK-SDERWTLLVRKVSSAKAISSLSLPKRKREEDPRMAMDHQDMTSFKL 364 >ref|XP_011086988.1| BTB/POZ and TAZ domain-containing protein 1 isoform X1 [Sesamum indicum] Length = 353 Score = 80.1 bits (196), Expect = 8e-15 Identities = 43/60 (71%), Positives = 49/60 (81%), Gaps = 2/60 (3%) Frame = -1 Query: 450 REFKLKVVQERQRGSDLLWRLLVRKVASAKAI--LSLPKRKREEEPRMDMDHQEMSSFKL 277 R+FKLK Q+ + GSD WRLLVRKVASAKA+ LSLPKRKREEEPRM MD++EM S KL Sbjct: 293 RQFKLKAQQDPRGGSDERWRLLVRKVASAKAMSSLSLPKRKREEEPRMGMDNREMRSIKL 352 >gb|PIN27034.1| CREB binding protein/P300 [Handroanthus impetiginosus] Length = 359 Score = 75.9 bits (185), Expect = 3e-13 Identities = 42/60 (70%), Positives = 47/60 (78%), Gaps = 2/60 (3%) Frame = -1 Query: 450 REFKLKVVQERQRGSDLLWRLLVRKVASAKAI--LSLPKRKREEEPRMDMDHQEMSSFKL 277 R+FKLK Q+R RG+D WRLLV+KV SA+AI LSLPKRKREEE RM MDHQ M S KL Sbjct: 301 RQFKLKAQQDR-RGNDARWRLLVKKVVSARAISSLSLPKRKREEEQRMGMDHQGMRSIKL 359 >gb|PIN25520.1| CREB binding protein/P300 [Handroanthus impetiginosus] Length = 359 Score = 74.3 bits (181), Expect = 1e-12 Identities = 40/60 (66%), Positives = 47/60 (78%), Gaps = 2/60 (3%) Frame = -1 Query: 450 REFKLKVVQERQRGSDLLWRLLVRKVASAKAI--LSLPKRKREEEPRMDMDHQEMSSFKL 277 R+FKLK Q+R RG+D WRLL++KV SA+AI LSLPKRKRE+E RM MDHQ M S KL Sbjct: 301 RQFKLKAQQDR-RGNDARWRLLIKKVVSARAISSLSLPKRKREQEQRMGMDHQGMRSIKL 359 >ref|XP_019247444.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 1-like [Nicotiana attenuata] gb|OIT02179.1| btbpoz and taz domain-containing protein 1 [Nicotiana attenuata] Length = 355 Score = 71.6 bits (174), Expect = 9e-12 Identities = 37/60 (61%), Positives = 48/60 (80%), Gaps = 2/60 (3%) Frame = -1 Query: 450 REFKLKVVQERQRGSDLLWRLLVRKVASAKAI--LSLPKRKREEEPRMDMDHQEMSSFKL 277 R+F+LK+ +QRG D LW+ LVRKV SAKAI LSLPKRKREEEPR+++ H ++ SF+L Sbjct: 294 RQFELKL---QQRGDDALWKSLVRKVVSAKAISTLSLPKRKREEEPRLNLSHHQVRSFRL 350 >ref|XP_015079907.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 1-like [Solanum pennellii] Length = 349 Score = 71.2 bits (173), Expect = 1e-11 Identities = 36/60 (60%), Positives = 49/60 (81%), Gaps = 2/60 (3%) Frame = -1 Query: 450 REFKLKVVQERQRGSDLLWRLLVRKVASAKAI--LSLPKRKREEEPRMDMDHQEMSSFKL 277 R+FKLKV +Q+G D LW+ LVRKV SA+A+ LSLPKRKREEEP+MD++H ++ +F+L Sbjct: 291 RQFKLKV---QQKGDDELWKSLVRKVVSARAMSSLSLPKRKREEEPKMDLNHHQVMNFRL 347 >emb|CDP15082.1| unnamed protein product [Coffea canephora] Length = 355 Score = 71.2 bits (173), Expect = 1e-11 Identities = 38/60 (63%), Positives = 46/60 (76%), Gaps = 2/60 (3%) Frame = -1 Query: 450 REFKLKVVQERQRGSDLLWRLLVRKVASAKAI--LSLPKRKREEEPRMDMDHQEMSSFKL 277 R+FKLK QE+ +G D W+LLVRKV SAKA+ LSLPKRKREEEPR+++ H M SF L Sbjct: 297 RQFKLKAQQEK-KGEDARWKLLVRKVISAKALSSLSLPKRKREEEPRLNLSHPGMRSFTL 355 >ref|XP_006347421.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 1-like [Solanum tuberosum] Length = 349 Score = 70.5 bits (171), Expect = 2e-11 Identities = 36/60 (60%), Positives = 48/60 (80%), Gaps = 2/60 (3%) Frame = -1 Query: 450 REFKLKVVQERQRGSDLLWRLLVRKVASAKAI--LSLPKRKREEEPRMDMDHQEMSSFKL 277 R+FKLKV +Q+G D LW+ LVRKV SA+A+ LSLPKRKREEEP+MD+ H ++ +F+L Sbjct: 291 RQFKLKV---QQKGDDELWKSLVRKVVSARAMSSLSLPKRKREEEPKMDLSHPQVMNFRL 347 >ref|XP_004241527.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 1-like [Solanum lycopersicum] Length = 349 Score = 70.5 bits (171), Expect = 2e-11 Identities = 36/60 (60%), Positives = 48/60 (80%), Gaps = 2/60 (3%) Frame = -1 Query: 450 REFKLKVVQERQRGSDLLWRLLVRKVASAKAI--LSLPKRKREEEPRMDMDHQEMSSFKL 277 R+FKLKV +Q+G D LW+ LVRKV SA+A+ LSLPKRKREEEP+MD +H ++ +F+L Sbjct: 291 RQFKLKV---QQKGDDELWKSLVRKVVSARAMSSLSLPKRKREEEPKMDFNHHQVMNFRL 347 >ref|XP_009767207.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 1-like [Nicotiana sylvestris] ref|XP_016496185.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 1-like [Nicotiana tabacum] Length = 374 Score = 69.7 bits (169), Expect = 5e-11 Identities = 36/60 (60%), Positives = 48/60 (80%), Gaps = 2/60 (3%) Frame = -1 Query: 450 REFKLKVVQERQRGSDLLWRLLVRKVASAKAI--LSLPKRKREEEPRMDMDHQEMSSFKL 277 R+FK+KV +QRG D LW+ LVRKV SA+A+ LSLPKRKREEEPRM++ H ++ +F+L Sbjct: 316 RQFKVKV---QQRGDDELWKSLVRKVVSARAMSSLSLPKRKREEEPRMNLSHHQVINFRL 372 >gb|EYU17772.1| hypothetical protein MIMGU_mgv1a009657mg [Erythranthe guttata] Length = 335 Score = 68.6 bits (166), Expect = 1e-10 Identities = 33/49 (67%), Positives = 41/49 (83%) Frame = -1 Query: 423 ERQRGSDLLWRLLVRKVASAKAILSLPKRKREEEPRMDMDHQEMSSFKL 277 E +RGSD+ W LLV+KVAS KA+L++PKRKRE+E RMD+DHQ M S KL Sbjct: 282 EDRRGSDVRWSLLVKKVASVKAMLTIPKRKREDELRMDVDHQIMRSSKL 330 >gb|PHU05308.1| BTB/POZ and TAZ domain-containing protein 1 [Capsicum chinense] Length = 349 Score = 68.6 bits (166), Expect = 1e-10 Identities = 36/60 (60%), Positives = 47/60 (78%), Gaps = 2/60 (3%) Frame = -1 Query: 450 REFKLKVVQERQRGSDLLWRLLVRKVASAKAI--LSLPKRKREEEPRMDMDHQEMSSFKL 277 R+FKLKV +QRG D LW+ LVRKV SA+A+ LSLPKRKR +EP+MD+ H E+ +F+L Sbjct: 291 RQFKLKV---QQRGDDDLWKSLVRKVVSARAMSSLSLPKRKRVDEPKMDLGHHEVMNFRL 347 >gb|PHT63283.1| BTB/POZ and TAZ domain-containing protein 1 [Capsicum annuum] Length = 349 Score = 68.6 bits (166), Expect = 1e-10 Identities = 36/60 (60%), Positives = 47/60 (78%), Gaps = 2/60 (3%) Frame = -1 Query: 450 REFKLKVVQERQRGSDLLWRLLVRKVASAKAI--LSLPKRKREEEPRMDMDHQEMSSFKL 277 R+FKLKV +QRG D LW+ LVRKV SA+A+ LSLPKRKR +EP+MD+ H E+ +F+L Sbjct: 291 RQFKLKV---QQRGDDDLWKSLVRKVVSARAMSSLSLPKRKRVDEPKMDLGHHEVMNFRL 347 >ref|XP_016578245.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 1-like [Capsicum annuum] Length = 349 Score = 68.6 bits (166), Expect = 1e-10 Identities = 36/60 (60%), Positives = 47/60 (78%), Gaps = 2/60 (3%) Frame = -1 Query: 450 REFKLKVVQERQRGSDLLWRLLVRKVASAKAI--LSLPKRKREEEPRMDMDHQEMSSFKL 277 R+FKLKV +QRG D LW+ LVRKV SA+A+ LSLPKRKR +EP+MD+ H E+ +F+L Sbjct: 291 RQFKLKV---QQRGDDDLWKSLVRKVVSARAMSSLSLPKRKRVDEPKMDLGHHEVMNFRL 347 >ref|XP_012829228.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 1-like [Erythranthe guttata] ref|XP_012829229.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 1-like [Erythranthe guttata] Length = 362 Score = 68.6 bits (166), Expect = 1e-10 Identities = 33/49 (67%), Positives = 41/49 (83%) Frame = -1 Query: 423 ERQRGSDLLWRLLVRKVASAKAILSLPKRKREEEPRMDMDHQEMSSFKL 277 E +RGSD+ W LLV+KVAS KA+L++PKRKRE+E RMD+DHQ M S KL Sbjct: 309 EDRRGSDVRWSLLVKKVASVKAMLTIPKRKREDELRMDVDHQIMRSSKL 357 >ref|XP_009631253.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 1-like isoform X2 [Nicotiana tomentosiformis] ref|XP_016462366.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 1-like isoform X2 [Nicotiana tabacum] Length = 284 Score = 67.8 bits (164), Expect = 1e-10 Identities = 36/60 (60%), Positives = 45/60 (75%), Gaps = 2/60 (3%) Frame = -1 Query: 450 REFKLKVVQERQRGSDLLWRLLVRKVASAKAI--LSLPKRKREEEPRMDMDHQEMSSFKL 277 R+FK+KV + RG D LW+ LVRKV SA+A+ LSLPKRKREEEPRMD+ H + +F L Sbjct: 226 RQFKVKV---QHRGDDELWKSLVRKVVSARAMSSLSLPKRKREEEPRMDLSHHRVINFML 282 >ref|XP_009631252.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 1-like isoform X1 [Nicotiana tomentosiformis] ref|XP_016462365.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 1-like isoform X1 [Nicotiana tabacum] ref|XP_018621988.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 1-like isoform X1 [Nicotiana tomentosiformis] Length = 346 Score = 67.8 bits (164), Expect = 2e-10 Identities = 36/60 (60%), Positives = 45/60 (75%), Gaps = 2/60 (3%) Frame = -1 Query: 450 REFKLKVVQERQRGSDLLWRLLVRKVASAKAI--LSLPKRKREEEPRMDMDHQEMSSFKL 277 R+FK+KV + RG D LW+ LVRKV SA+A+ LSLPKRKREEEPRMD+ H + +F L Sbjct: 288 RQFKVKV---QHRGDDELWKSLVRKVVSARAMSSLSLPKRKREEEPRMDLSHHRVINFML 344 >emb|CBI14900.3| unnamed protein product, partial [Vitis vinifera] Length = 347 Score = 67.4 bits (163), Expect = 3e-10 Identities = 37/61 (60%), Positives = 47/61 (77%), Gaps = 3/61 (4%) Frame = -1 Query: 450 REFKLKVVQERQRGSDLLWRLLVRKVASAKAI--LSLPKRKREEEPRMDMDHQE-MSSFK 280 R+FKLK Q+ ++G D W+LLVRKV SAKA+ LSLPKRKREEEPR +DH+ + SF+ Sbjct: 288 RQFKLKA-QQVKKGEDARWKLLVRKVVSAKAMSSLSLPKRKREEEPRQTLDHRHGLGSFR 346 Query: 279 L 277 L Sbjct: 347 L 347 >ref|XP_019247443.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 1-like [Nicotiana attenuata] gb|OIT02177.1| btbpoz and taz domain-containing protein 1 [Nicotiana attenuata] Length = 349 Score = 67.4 bits (163), Expect = 3e-10 Identities = 36/60 (60%), Positives = 46/60 (76%), Gaps = 2/60 (3%) Frame = -1 Query: 450 REFKLKVVQERQRGSDLLWRLLVRKVASAKAI--LSLPKRKREEEPRMDMDHQEMSSFKL 277 R+FK+KV +QRG D LW+ LVRKV SA+A+ LSLPKRKREEEPRM + H ++ +F L Sbjct: 291 RQFKVKV---QQRGDDELWKSLVRKVVSARAMSSLSLPKRKREEEPRMYLSHHQVINFSL 347