BLASTX nr result
ID: Rehmannia29_contig00028102
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00028102 (898 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011097906.1| FHA domain-containing protein DDL [Sesamum i... 76 9e-12 ref|XP_012841740.1| PREDICTED: FHA domain-containing protein DDL... 76 1e-11 gb|PIN09906.1| Transcriptional regulator SNIP1, contains FHA dom... 75 2e-11 emb|CDP05777.1| unnamed protein product [Coffea canephora] 69 1e-09 ref|XP_022734876.1| FHA domain-containing protein DDL-like isofo... 69 2e-09 ref|XP_019251784.1| PREDICTED: FHA domain-containing protein DDL... 68 4e-09 ref|XP_009799950.1| PREDICTED: smad nuclear interacting protein ... 67 1e-08 ref|XP_009799948.1| PREDICTED: FHA domain-containing protein DDL... 67 1e-08 ref|XP_023903182.1| FHA domain-containing protein DDL-like isofo... 67 1e-08 ref|XP_023903181.1| FHA domain-containing protein DDL-like isofo... 67 1e-08 ref|XP_023903180.1| FHA domain-containing protein DDL-like isofo... 67 1e-08 ref|XP_023903179.1| FHA domain-containing protein DDL-like isofo... 67 1e-08 ref|XP_017616428.1| PREDICTED: FHA domain-containing protein DDL... 66 1e-08 ref|XP_016674054.1| PREDICTED: FHA domain-containing protein DDL... 66 1e-08 gb|PPR99454.1| hypothetical protein GOBAR_AA21210 [Gossypium bar... 66 2e-08 gb|KJB81759.1| hypothetical protein B456_013G161200 [Gossypium r... 65 3e-08 gb|KJB81757.1| hypothetical protein B456_013G161200 [Gossypium r... 65 3e-08 gb|PHT69599.1| Smad nuclear-interacting protein 1 [Capsicum annu... 65 3e-08 gb|PHT35437.1| Smad nuclear-interacting protein 1 [Capsicum bacc... 65 3e-08 ref|XP_012464336.1| PREDICTED: FHA domain-containing protein DDL... 65 3e-08 >ref|XP_011097906.1| FHA domain-containing protein DDL [Sesamum indicum] ref|XP_011097908.1| FHA domain-containing protein DDL [Sesamum indicum] ref|XP_011097910.1| FHA domain-containing protein DDL [Sesamum indicum] Length = 420 Score = 75.9 bits (185), Expect = 9e-12 Identities = 37/44 (84%), Positives = 40/44 (90%) Frame = +3 Query: 765 QLTNSRDSEHRNGDSDSIAKMKAVEETLDAKEKQKPSFELSGKL 896 +LTNSRD+E RN DSDSIAKMKA EE L+AKEKQKPSFELSGKL Sbjct: 232 ELTNSRDTEQRNSDSDSIAKMKAAEEKLEAKEKQKPSFELSGKL 275 >ref|XP_012841740.1| PREDICTED: FHA domain-containing protein DDL [Erythranthe guttata] gb|EYU33620.1| hypothetical protein MIMGU_mgv1a006541mg [Erythranthe guttata] Length = 440 Score = 75.9 bits (185), Expect = 1e-11 Identities = 36/44 (81%), Positives = 40/44 (90%) Frame = +3 Query: 765 QLTNSRDSEHRNGDSDSIAKMKAVEETLDAKEKQKPSFELSGKL 896 ++ NSRDSE RNGD DS+AKMKA EETL+AKEKQKPSFELSGKL Sbjct: 252 EVANSRDSEPRNGDDDSVAKMKAAEETLEAKEKQKPSFELSGKL 295 >gb|PIN09906.1| Transcriptional regulator SNIP1, contains FHA domain [Handroanthus impetiginosus] Length = 435 Score = 75.1 bits (183), Expect = 2e-11 Identities = 37/44 (84%), Positives = 39/44 (88%) Frame = +3 Query: 765 QLTNSRDSEHRNGDSDSIAKMKAVEETLDAKEKQKPSFELSGKL 896 +L NSR E RNGDSDSIAKMKA EETL+AKEKQKPSFELSGKL Sbjct: 247 ELANSRHPEQRNGDSDSIAKMKAAEETLEAKEKQKPSFELSGKL 290 >emb|CDP05777.1| unnamed protein product [Coffea canephora] Length = 402 Score = 69.3 bits (168), Expect = 1e-09 Identities = 31/42 (73%), Positives = 38/42 (90%) Frame = +3 Query: 771 TNSRDSEHRNGDSDSIAKMKAVEETLDAKEKQKPSFELSGKL 896 TNSR S+HRNG++DS+AKMKA E L++KEK+KPSFELSGKL Sbjct: 216 TNSRGSDHRNGENDSVAKMKATESALESKEKEKPSFELSGKL 257 >ref|XP_022734876.1| FHA domain-containing protein DDL-like isoform X2 [Durio zibethinus] Length = 378 Score = 68.6 bits (166), Expect = 2e-09 Identities = 33/56 (58%), Positives = 43/56 (76%) Frame = +3 Query: 729 NRTSPNNFSKFLQLTNSRDSEHRNGDSDSIAKMKAVEETLDAKEKQKPSFELSGKL 896 +R+ +N ++TNSRD+E R D DS+AKMKA EE L+AK+KQKP+FELSGKL Sbjct: 178 SRSPASNSRARDEVTNSRDAEQRRDDEDSVAKMKAAEEALEAKQKQKPTFELSGKL 233 >ref|XP_019251784.1| PREDICTED: FHA domain-containing protein DDL [Nicotiana attenuata] gb|OIS99110.1| fha domain-containing protein ddl [Nicotiana attenuata] Length = 527 Score = 68.2 bits (165), Expect = 4e-09 Identities = 31/44 (70%), Positives = 37/44 (84%) Frame = +3 Query: 765 QLTNSRDSEHRNGDSDSIAKMKAVEETLDAKEKQKPSFELSGKL 896 ++TNSR EHRNGD DS++KM+A EE L+AK K KPSFELSGKL Sbjct: 340 EVTNSRRGEHRNGDDDSLSKMQAAEEALEAKNKDKPSFELSGKL 383 >ref|XP_009799950.1| PREDICTED: smad nuclear interacting protein 1 isoform X2 [Nicotiana sylvestris] Length = 485 Score = 67.0 bits (162), Expect = 1e-08 Identities = 30/44 (68%), Positives = 37/44 (84%) Frame = +3 Query: 765 QLTNSRDSEHRNGDSDSIAKMKAVEETLDAKEKQKPSFELSGKL 896 ++TNSR EHRNGD DS++KM+A EE L++K K KPSFELSGKL Sbjct: 341 EVTNSRRGEHRNGDDDSLSKMQAAEEALESKNKDKPSFELSGKL 384 >ref|XP_009799948.1| PREDICTED: FHA domain-containing protein DDL isoform X1 [Nicotiana sylvestris] ref|XP_009799949.1| PREDICTED: FHA domain-containing protein DDL isoform X1 [Nicotiana sylvestris] ref|XP_016460057.1| PREDICTED: FHA domain-containing protein DDL [Nicotiana tabacum] ref|XP_016460060.1| PREDICTED: FHA domain-containing protein DDL [Nicotiana tabacum] Length = 528 Score = 67.0 bits (162), Expect = 1e-08 Identities = 30/44 (68%), Positives = 37/44 (84%) Frame = +3 Query: 765 QLTNSRDSEHRNGDSDSIAKMKAVEETLDAKEKQKPSFELSGKL 896 ++TNSR EHRNGD DS++KM+A EE L++K K KPSFELSGKL Sbjct: 341 EVTNSRRGEHRNGDDDSLSKMQAAEEALESKNKDKPSFELSGKL 384 >ref|XP_023903182.1| FHA domain-containing protein DDL-like isoform X4 [Quercus suber] Length = 413 Score = 66.6 bits (161), Expect = 1e-08 Identities = 31/44 (70%), Positives = 38/44 (86%) Frame = +3 Query: 765 QLTNSRDSEHRNGDSDSIAKMKAVEETLDAKEKQKPSFELSGKL 896 ++TN R SE RN ++DS+AKMKA +E L+AKEKQKPSFELSGKL Sbjct: 273 KVTNLRGSEERNNENDSVAKMKAAQEALEAKEKQKPSFELSGKL 316 >ref|XP_023903181.1| FHA domain-containing protein DDL-like isoform X3 [Quercus suber] Length = 419 Score = 66.6 bits (161), Expect = 1e-08 Identities = 31/44 (70%), Positives = 38/44 (86%) Frame = +3 Query: 765 QLTNSRDSEHRNGDSDSIAKMKAVEETLDAKEKQKPSFELSGKL 896 ++TN R SE RN ++DS+AKMKA +E L+AKEKQKPSFELSGKL Sbjct: 273 KVTNLRGSEERNNENDSVAKMKAAQEALEAKEKQKPSFELSGKL 316 >ref|XP_023903180.1| FHA domain-containing protein DDL-like isoform X2 [Quercus suber] Length = 460 Score = 66.6 bits (161), Expect = 1e-08 Identities = 31/44 (70%), Positives = 38/44 (86%) Frame = +3 Query: 765 QLTNSRDSEHRNGDSDSIAKMKAVEETLDAKEKQKPSFELSGKL 896 ++TN R SE RN ++DS+AKMKA +E L+AKEKQKPSFELSGKL Sbjct: 273 KVTNLRGSEERNNENDSVAKMKAAQEALEAKEKQKPSFELSGKL 316 >ref|XP_023903179.1| FHA domain-containing protein DDL-like isoform X1 [Quercus suber] gb|POE46697.1| fha domain-containing protein ddl [Quercus suber] Length = 461 Score = 66.6 bits (161), Expect = 1e-08 Identities = 31/44 (70%), Positives = 38/44 (86%) Frame = +3 Query: 765 QLTNSRDSEHRNGDSDSIAKMKAVEETLDAKEKQKPSFELSGKL 896 ++TN R SE RN ++DS+AKMKA +E L+AKEKQKPSFELSGKL Sbjct: 273 KVTNLRGSEERNNENDSVAKMKAAQEALEAKEKQKPSFELSGKL 316 >ref|XP_017616428.1| PREDICTED: FHA domain-containing protein DDL isoform X4 [Gossypium arboreum] Length = 372 Score = 66.2 bits (160), Expect = 1e-08 Identities = 31/56 (55%), Positives = 43/56 (76%) Frame = +3 Query: 729 NRTSPNNFSKFLQLTNSRDSEHRNGDSDSIAKMKAVEETLDAKEKQKPSFELSGKL 896 +R+ +N ++ NSR +EHR+ + DS+AKMKA EE L+AK+KQKP+FELSGKL Sbjct: 172 SRSPASNSRSRDEVNNSRGAEHRDDEDDSVAKMKAAEEALEAKQKQKPTFELSGKL 227 >ref|XP_016674054.1| PREDICTED: FHA domain-containing protein DDL-like isoform X4 [Gossypium hirsutum] Length = 372 Score = 66.2 bits (160), Expect = 1e-08 Identities = 31/56 (55%), Positives = 43/56 (76%) Frame = +3 Query: 729 NRTSPNNFSKFLQLTNSRDSEHRNGDSDSIAKMKAVEETLDAKEKQKPSFELSGKL 896 +R+ +N ++ NSR +EHR+ + DS+AKMKA EE L+AK+KQKP+FELSGKL Sbjct: 172 SRSPASNSRSRDEVNNSRGAEHRDDEDDSVAKMKAAEEALEAKQKQKPTFELSGKL 227 >gb|PPR99454.1| hypothetical protein GOBAR_AA21210 [Gossypium barbadense] Length = 580 Score = 66.2 bits (160), Expect = 2e-08 Identities = 31/56 (55%), Positives = 43/56 (76%) Frame = +3 Query: 729 NRTSPNNFSKFLQLTNSRDSEHRNGDSDSIAKMKAVEETLDAKEKQKPSFELSGKL 896 +R+ +N ++ NSR +EHR+ + DS+AKMKA EE L+AK+KQKP+FELSGKL Sbjct: 172 SRSPASNSRSRDEVNNSRGAEHRDDEDDSVAKMKAAEEALEAKQKQKPTFELSGKL 227 >gb|KJB81759.1| hypothetical protein B456_013G161200 [Gossypium raimondii] Length = 328 Score = 65.1 bits (157), Expect = 3e-08 Identities = 30/56 (53%), Positives = 43/56 (76%) Frame = +3 Query: 729 NRTSPNNFSKFLQLTNSRDSEHRNGDSDSIAKMKAVEETLDAKEKQKPSFELSGKL 896 +R+ +N ++ NSR +EHR+ + DS+AKMKA E+ L+AK+KQKP+FELSGKL Sbjct: 172 SRSPASNSRSRDEVNNSRGAEHRDDEDDSVAKMKAAEDALEAKQKQKPTFELSGKL 227 >gb|KJB81757.1| hypothetical protein B456_013G161200 [Gossypium raimondii] Length = 333 Score = 65.1 bits (157), Expect = 3e-08 Identities = 30/56 (53%), Positives = 43/56 (76%) Frame = +3 Query: 729 NRTSPNNFSKFLQLTNSRDSEHRNGDSDSIAKMKAVEETLDAKEKQKPSFELSGKL 896 +R+ +N ++ NSR +EHR+ + DS+AKMKA E+ L+AK+KQKP+FELSGKL Sbjct: 172 SRSPASNSRSRDEVNNSRGAEHRDDEDDSVAKMKAAEDALEAKQKQKPTFELSGKL 227 >gb|PHT69599.1| Smad nuclear-interacting protein 1 [Capsicum annuum] gb|PHU04138.1| Smad nuclear-interacting protein 1 [Capsicum chinense] Length = 522 Score = 65.5 bits (158), Expect = 3e-08 Identities = 30/44 (68%), Positives = 35/44 (79%) Frame = +3 Query: 765 QLTNSRDSEHRNGDSDSIAKMKAVEETLDAKEKQKPSFELSGKL 896 + TNSR EHRNG+ DS++KMK EE L+AK K KPSFELSGKL Sbjct: 334 EATNSRRGEHRNGEDDSLSKMKEAEEALEAKNKDKPSFELSGKL 377 >gb|PHT35437.1| Smad nuclear-interacting protein 1 [Capsicum baccatum] Length = 522 Score = 65.5 bits (158), Expect = 3e-08 Identities = 30/44 (68%), Positives = 35/44 (79%) Frame = +3 Query: 765 QLTNSRDSEHRNGDSDSIAKMKAVEETLDAKEKQKPSFELSGKL 896 + TNSR EHRNG+ DS++KMK EE L+AK K KPSFELSGKL Sbjct: 334 EATNSRRGEHRNGEDDSLSKMKEAEEALEAKNKDKPSFELSGKL 377 >ref|XP_012464336.1| PREDICTED: FHA domain-containing protein DDL isoform X3 [Gossypium raimondii] gb|KJB81754.1| hypothetical protein B456_013G161200 [Gossypium raimondii] Length = 372 Score = 65.1 bits (157), Expect = 3e-08 Identities = 30/56 (53%), Positives = 43/56 (76%) Frame = +3 Query: 729 NRTSPNNFSKFLQLTNSRDSEHRNGDSDSIAKMKAVEETLDAKEKQKPSFELSGKL 896 +R+ +N ++ NSR +EHR+ + DS+AKMKA E+ L+AK+KQKP+FELSGKL Sbjct: 172 SRSPASNSRSRDEVNNSRGAEHRDDEDDSVAKMKAAEDALEAKQKQKPTFELSGKL 227