BLASTX nr result
ID: Rehmannia29_contig00028099
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00028099 (477 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011069830.1| protein FLX-like 4 [Sesamum indicum] >gi|747... 69 6e-11 gb|PIN02607.1| hypothetical protein CDL12_24882 [Handroanthus im... 58 8e-07 >ref|XP_011069830.1| protein FLX-like 4 [Sesamum indicum] ref|XP_011069831.1| protein FLX-like 4 [Sesamum indicum] ref|XP_011069832.1| protein FLX-like 4 [Sesamum indicum] ref|XP_020547645.1| protein FLX-like 4 [Sesamum indicum] Length = 315 Score = 69.3 bits (168), Expect = 6e-11 Identities = 33/57 (57%), Positives = 38/57 (66%), Gaps = 4/57 (7%) Frame = +3 Query: 3 GTHLQTINGAAVEGMNPYAGGGFAVGPQVIGGPVVSGGA----NPAWGGVYDTSHTQ 161 G +L T+ G AV GMNPYA GGFAVGP VI GP A NP+WG +Y+ SHTQ Sbjct: 258 GPYLHTVGGTAVAGMNPYAVGGFAVGPPVITGPAAGASAVAAGNPSWGVMYNISHTQ 314 >gb|PIN02607.1| hypothetical protein CDL12_24882 [Handroanthus impetiginosus] Length = 307 Score = 57.8 bits (138), Expect = 8e-07 Identities = 28/44 (63%), Positives = 28/44 (63%), Gaps = 1/44 (2%) Frame = +3 Query: 27 GAAVEGMNPYAGGGFAVGPQVIGGPVVSGGA-NPAWGGVYDTSH 155 GA VEG NPYA GGF VGP I GP S A NPAW G YD H Sbjct: 263 GAPVEGPNPYANGGFVVGPPAIHGPPGSRAAGNPAWAGAYDAPH 306